Protein Info for Psyr_0758 in Pseudomonas syringae pv. syringae B728a

Annotation: beta-fructofuranosidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 493 TIGR01322: sucrose-6-phosphate hydrolase" amino acids 26 to 463 (438 residues), 443.3 bits, see alignment E=4.6e-137 PF00251: Glyco_hydro_32N" amino acids 32 to 333 (302 residues), 349.3 bits, see alignment E=2.6e-108 PF08244: Glyco_hydro_32C" amino acids 337 to 486 (150 residues), 100.5 bits, see alignment E=9.9e-33

Best Hits

KEGG orthology group: K01193, beta-fructofuranosidase [EC: 3.2.1.26] (inferred from 100% identity to psb:Psyr_0758)

Predicted SEED Role

No annotation

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.2.1.26

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZYF6 at UniProt or InterPro

Protein Sequence (493 amino acids)

>Psyr_0758 beta-fructofuranosidase (Pseudomonas syringae pv. syringae B728a)
MSNPMSPALERAHHALEEGLSQLIHDYRPGYHLAPPAGWMNDPNGVVFFRGEYHVFYQHH
PFDAKWGPMYWGHAKSADLVHWQHLPIALAPGDDFDRDGCFSGSAVVCGDTLALIYTGHI
WLGDVGDERFIRQVQCLATSTDGISFVKHGAVIDTPPQDEMIHFRDPKVWRQDGHWYLIA
GARLGDKPLLPLYRSKDLHAWEFVSYVSSGEEGDGYMWECPDLFGLNERDVLLYSPQGMP
AQRYERLNRFHTGYRVGQVDSQWQFTGGPFIELDSGHDFYAAQTLVAADGRRLLWAWIDM
WESPTPTEAHHWRGMLGLPRELEVRENRLCVHPARELTALRDASLPGTAWWSDAGSQWLT
DIHGDMLEIHVQLDLLDCIEGHLGVALRCSPDGQEQTLLYYDASLKRLILDRTQSGTHVS
GQRSVAIDPQQNQLELRIFLDRSSIEVFEQNGSFSFSSRLYPQTDSLGVKLVANGTGGRV
CIANAWQLSSGYL