Protein Info for Psyr_0711 in Pseudomonas syringae pv. syringae B728a

Annotation: signal peptidase II, Aspartic peptidase, MEROPS family A08

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 168 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details transmembrane" amino acids 68 to 87 (20 residues), see Phobius details amino acids 95 to 113 (19 residues), see Phobius details amino acids 133 to 154 (22 residues), see Phobius details TIGR00077: signal peptidase II" amino acids 9 to 161 (153 residues), 132 bits, see alignment E=9.8e-43 PF01252: Peptidase_A8" amino acids 15 to 157 (143 residues), 147.9 bits, see alignment E=1.2e-47

Best Hits

Swiss-Prot: 91% identical to LSPA_PSESM: Lipoprotein signal peptidase (lspA) from Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)

KEGG orthology group: K03101, signal peptidase II [EC: 3.4.23.36] (inferred from 100% identity to psb:Psyr_0711)

Predicted SEED Role

"Lipoprotein signal peptidase (EC 3.4.23.36)" in subsystem Sex pheromones in Enterococcus faecalis and other Firmicutes or Signal peptidase (EC 3.4.23.36)

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.4.23.36

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZYJ3 at UniProt or InterPro

Protein Sequence (168 amino acids)

>Psyr_0711 signal peptidase II, Aspartic peptidase, MEROPS family A08 (Pseudomonas syringae pv. syringae B728a)
MPNASFGRLAWLWLSVLVLVIDQASKYYFENALSLYQQIIVIPDLFSWTLAYNTGAAFSF
LADGAGWQRWLFALIAVVVSAVLVVWLKRLGRDDTWLAVALALVLGGALGNLYDRIVLGH
VIDFILVHWQNRWYFPAFNVADSAISVGAVMLALDMFKSKKTGETVND