Protein Info for Psyr_0676 in Pseudomonas syringae pv. syringae B728a

Annotation: Xanthine/uracil permease family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 465 transmembrane" amino acids 22 to 46 (25 residues), see Phobius details amino acids 55 to 73 (19 residues), see Phobius details amino acids 82 to 104 (23 residues), see Phobius details amino acids 116 to 135 (20 residues), see Phobius details amino acids 145 to 166 (22 residues), see Phobius details amino acids 178 to 197 (20 residues), see Phobius details amino acids 204 to 224 (21 residues), see Phobius details amino acids 250 to 270 (21 residues), see Phobius details amino acids 335 to 356 (22 residues), see Phobius details amino acids 363 to 384 (22 residues), see Phobius details amino acids 393 to 413 (21 residues), see Phobius details amino acids 423 to 442 (20 residues), see Phobius details TIGR00801: uracil-xanthine permease" amino acids 21 to 440 (420 residues), 369.4 bits, see alignment E=2.4e-114 PF00860: Xan_ur_permease" amino acids 24 to 411 (388 residues), 296.4 bits, see alignment E=1.4e-92 TIGR03173: xanthine permease" amino acids 28 to 442 (415 residues), 423.6 bits, see alignment E=7.4e-131

Best Hits

Swiss-Prot: 46% identical to XANQ_ECOLI: Xanthine permease XanQ (xanQ) from Escherichia coli (strain K12)

KEGG orthology group: K03458, nucleobase:cation symporter-2, NCS2 family (inferred from 100% identity to psb:Psyr_0676)

MetaCyc: 46% identical to xanthine:H+ symporter XanQ (Escherichia coli K-12 substr. MG1655)
RXN-5076

Predicted SEED Role

"Xanthine permease" in subsystem Purine Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZYM6 at UniProt or InterPro

Protein Sequence (465 amino acids)

>Psyr_0676 Xanthine/uracil permease family (Pseudomonas syringae pv. syringae B728a)
MQPETLDNDDLIYGLNDRPKPWTAILAAFQHVLASFVGIITPPLIIGSTLGLTPYMPYLI
SMALMVSGTGTFIQARRPFGIGAGMICLQGTSFAFLGAVLSAGFLVKQRGGSPEDIMAMI
FGVCFFGALVQIALSRCISQLRRVITPLVTGIVITLIGVSLIKVGVTDLGGGFNAPDFGA
PVNLALGAFVLAVIIVLNRSNTPWVRLSAIIIGLAVGSLAAWFSGKLVPQALHDLPLISV
PVPFRFGFNFDWSAFLPVALIYLISSIETVGDLTANCMLARQPISGPSYLARLKGGVLGD
GVSCMIAATFSAFPNTTFAQNNGVIQLTGVASRYVGLYIGAVLFVLGLFPHIGAIVQQIP
KPVLGGATLVMFGSVAAAGVRILAQSPLDRRSMLIIATSLGVGLGIAAQPALLHQLPKLV
QNLFDSAITSGGITAIVMCLLIPEGKVTAATTDAVTEPEPVEQPR