Protein Info for Psyr_0675 in Pseudomonas syringae pv. syringae B728a

Annotation: transcriptional regulator, TetR family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 220 PF00440: TetR_N" amino acids 27 to 73 (47 residues), 44.7 bits, see alignment 8.9e-16 PF08362: TetR_C_3" amino acids 74 to 215 (142 residues), 195.1 bits, see alignment E=5.7e-62

Best Hits

Swiss-Prot: 43% identical to RUTR_ECOL6: HTH-type transcriptional regulator RutR (rutR) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K09017, TetR/AcrR family transcriptional regulator (inferred from 100% identity to psb:Psyr_0675)

Predicted SEED Role

"Transcriptional regulator RutR of pyrimidine catabolism (TetR family)" in subsystem Pyrimidine utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZYM7 at UniProt or InterPro

Protein Sequence (220 amino acids)

>Psyr_0675 transcriptional regulator, TetR family (Pseudomonas syringae pv. syringae B728a)
MTLEVPAHSAHVTKPASRIRQKNEEAIIQAAEDEFARHGFKGTSMNTIAIKAGLPKANLH
YYFTNKLGLYVAVLSNIIDLWDSTFNHLSVEDDPAEALARYIRAKMEFSRRQPQASRIFA
MEIISGGECMSEYFSQDYRLWFQGRAAVFQAWIDAGKMDPVDPVHLIFLLWGSTQHYADF
ASQICRVTGRSRLTRQDMDQASNNLIRIILKGCGLAPPAL