Protein Info for Psyr_0673 in Pseudomonas syringae pv. syringae B728a

Annotation: nucleoside ABC transporter ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 517 PF00005: ABC_tran" amino acids 27 to 171 (145 residues), 119.4 bits, see alignment E=2e-38 amino acids 276 to 434 (159 residues), 44.6 bits, see alignment E=2.4e-15

Best Hits

KEGG orthology group: K02056, simple sugar transport system ATP-binding protein [EC: 3.6.3.17] (inferred from 100% identity to psb:Psyr_0673)

Predicted SEED Role

"ABC transporter ATP-binding protein"

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.17

Use Curated BLAST to search for 3.6.3.17

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZYM9 at UniProt or InterPro

Protein Sequence (517 amino acids)

>Psyr_0673 nucleoside ABC transporter ATP-binding protein (Pseudomonas syringae pv. syringae B728a)
MSNHAIPARLQLRHITKRYPGCLANDAVDLTIQPGEIHALLGENGAGKSTLMKIIYGVTQ
PDAGTIIWQGQAQTMRNPAQARSLGIGMVFQHFSLFETLSVAQNIALAMGAAAGTPKQLE
PRIREVSQRYGMAVEPQRLVHSLSIGERQKVEIIRCLMQDIRLLILDEPTSVLTPQEAEE
LFVTLRHLAREGCSILFISHKLGEVRALCHSATVLRNGKVSGHCIPADCSDLELARLMVG
DAEGLTAHYEKVSGSTAFLRIDKLSWHNPDPFGCSLKDLSLEVRSGEIVGIAGVAGNGQD
ELLALLSGEQTLPHAQAATLRFEDAPVGNLRPDARRKRGLAFVPAERLGHGAVPELSLAD
NALLTAFQQGLVSNGLIQRSKVRALADEIIRRFAVKTPDAQAPARSLSGGNLQKFILGRE
ILQKPKLLIAAHPTWGVDVGAAAAIHRALIALRDAGAAILVISEDLDELFQISDRLAALS
GGQLSELIPTEQTSTVQIGGWMAGQFDHSHSQAHVAG