Protein Info for Psyr_0666 in Pseudomonas syringae pv. syringae B728a

Annotation: transport system permease protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 329 signal peptide" amino acids 1 to 36 (36 residues), see Phobius details transmembrane" amino acids 59 to 78 (20 residues), see Phobius details amino acids 90 to 112 (23 residues), see Phobius details amino acids 118 to 138 (21 residues), see Phobius details amino acids 149 to 171 (23 residues), see Phobius details amino acids 196 to 217 (22 residues), see Phobius details amino acids 237 to 264 (28 residues), see Phobius details amino acids 276 to 297 (22 residues), see Phobius details amino acids 308 to 325 (18 residues), see Phobius details PF01032: FecCD" amino acids 16 to 327 (312 residues), 278.5 bits, see alignment E=6.2e-87 PF00950: ABC-3" amino acids 153 to 323 (171 residues), 24.5 bits, see alignment E=1.9e-09

Best Hits

Swiss-Prot: 42% identical to FECC_ECOLI: Fe(3+) dicitrate transport system permease protein FecC (fecC) from Escherichia coli (strain K12)

KEGG orthology group: K02015, iron complex transport system permease protein (inferred from 100% identity to psb:Psyr_0666)

MetaCyc: 42% identical to ferric citrate ABC transporter membrane subunit FecC (Escherichia coli K-12 substr. MG1655)
ABC-9-RXN [EC: 7.2.2.18]

Predicted SEED Role

"Iron(III) dicitrate transport system permease protein FecC (TC 3.A.1.14.1)" (TC 3.A.1.14.1)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.2.2.18

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZYN6 at UniProt or InterPro

Protein Sequence (329 amino acids)

>Psyr_0666 transport system permease protein (Pseudomonas syringae pv. syringae B728a)
MRRWLMAGVIIAACLGLFWVSLFALSSFSIRQVDAWNGLITQGREGGNIAYIVAQLRVPR
ALCAALVGACLGVAGALMQGITRNRLASPSLFGVTAGAALGLALFSTGLVALPFPGGALL
MTCLGGALAWITVFSLGGAWSPATAQGRLVLAGVAVAALCAALTRLTVILVEAQAQSVLN
WLAGSLANVGAAQLQLLWPCTLIGVVLAVACAPRLNLINLGEDAARSLGVRIGALRMLVF
VVSLLLVGASVCAVGPIGFVGLIAPNIARQWLGNDYRWLIPISAGLGAAIVLASDLISRA
VAFPVETPAGVVTALIGAPFFLFLARRAL