Protein Info for Psyr_0652 in Pseudomonas syringae pv. syringae B728a

Annotation: Integrase, catalytic region

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 260 PF13276: HTH_21" amino acids 19 to 76 (58 residues), 37.6 bits, see alignment E=4.2e-13 PF00665: rve" amino acids 100 to 197 (98 residues), 92.4 bits, see alignment E=3.9e-30 PF13683: rve_3" amino acids 186 to 252 (67 residues), 47.6 bits, see alignment E=2.4e-16 PF13333: rve_2" amino acids 204 to 256 (53 residues), 27.4 bits, see alignment E=6.1e-10

Best Hits

KEGG orthology group: None (inferred from 100% identity to psb:Psyr_0988)

Predicted SEED Role

"Mobile element protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZXS8 at UniProt or InterPro

Protein Sequence (260 amino acids)

>Psyr_0652 Integrase, catalytic region (Pseudomonas syringae pv. syringae B728a)
MNRSRYYDYLKQRDRVDPDRERLKVEAIQLHTQSRRSMGARSLSAALKARGEQVGRFLAG
RLMAEAGLQSCQRRPRPYRHSVVQSRFAENLLERQFEVSAPNQVWCGDITYIWAGTRWVY
LAAVLDLYARRIVGWAISSTPDSTLTCKALALAHEARGKPHKVMFHSDQGCQYSSEMFRT
KLESLGMQQSMSRRGNCWDNAPMERFFGSLKSEWIPKKGYRNEEEARPDVLRYVIHHYNQ
VRLHSYNEYRTPVDQEKMAA