Protein Info for Psyr_0648 in Pseudomonas syringae pv. syringae B728a

Annotation: transporter, putative

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 342 transmembrane" amino acids 12 to 30 (19 residues), see Phobius details amino acids 43 to 60 (18 residues), see Phobius details amino acids 72 to 92 (21 residues), see Phobius details amino acids 103 to 125 (23 residues), see Phobius details amino acids 137 to 159 (23 residues), see Phobius details amino acids 171 to 189 (19 residues), see Phobius details amino acids 210 to 229 (20 residues), see Phobius details amino acids 235 to 255 (21 residues), see Phobius details amino acids 273 to 293 (21 residues), see Phobius details amino acids 298 to 320 (23 residues), see Phobius details PF13593: SBF_like" amino acids 13 to 324 (312 residues), 377.5 bits, see alignment E=5.8e-117 PF01758: SBF" amino acids 47 to 222 (176 residues), 39.2 bits, see alignment E=6.4e-14

Best Hits

Swiss-Prot: 40% identical to Y2026_PSEAE: Uncharacterized protein PA2026 (PA2026) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K14347, solute carrier family 10 (sodium/bile acid cotransporter), member 7 (inferred from 100% identity to psb:Psyr_0648)

Predicted SEED Role

"Sodium/bile acid symporter family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZYQ4 at UniProt or InterPro

Protein Sequence (342 amino acids)

>Psyr_0648 transporter, putative (Pseudomonas syringae pv. syringae B728a)
MQSLKHFKRVATDWFLWGMVLATVLAYFFPRFGATGGSMHAEYVIKVGVFVVFFLHGVNL
SSEQIKKGLTNWRLHVMIQVFTFVVFPLIWLACNKLLGSQVPALLMLGFLYLCALPSTIS
SSVALTGSAGGNVPAAILNASMSSVIGIFITPWLVSLVVGTGAGGIDLGDTLLDLCAMLL
LPLVLGQLMRPLLGKFFARHKKYTNLIDKLVILLLVYAAFCNSMISGMWQSQGNSVILTA
FIGTALLLAVILLMTTRTARVLKFDHADKVAAVFCATKKSLAAGAPMAALIFGSNPGLGL
ILLPIMIYHPMQLIVCSIIAESYASRHRQQLSAAALEEAQAA