Protein Info for Psyr_0634 in Pseudomonas syringae pv. syringae B728a

Annotation: MORN motif protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 575 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details PF02493: MORN" amino acids 35 to 56 (22 residues), 15 bits, see alignment (E = 1.9e-06) amino acids 58 to 80 (23 residues), 17.2 bits, see alignment (E = 3.7e-07) amino acids 81 to 98 (18 residues), 11.9 bits, see alignment (E = 1.8e-05) amino acids 104 to 119 (16 residues), 10.5 bits, see alignment (E = 5.2e-05) amino acids 126 to 147 (22 residues), 14.2 bits, see alignment (E = 3.5e-06) amino acids 150 to 170 (21 residues), 11.3 bits, see alignment (E = 2.9e-05) amino acids 172 to 193 (22 residues), 13.7 bits, see alignment (E = 4.9e-06) amino acids 195 to 217 (23 residues), 16 bits, see alignment (E = 9.3e-07) amino acids 219 to 240 (22 residues), 13.6 bits, see alignment (E = 5.2e-06) amino acids 264 to 284 (21 residues), 9.4 bits, see alignment (E = 0.00011) PF01650: Peptidase_C13" amino acids 401 to 542 (142 residues), 111.4 bits, see alignment E=5.7e-36

Best Hits

KEGG orthology group: None (inferred from 100% identity to psb:Psyr_0634)

Predicted SEED Role

"MORN repeat family protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZYR8 at UniProt or InterPro

Protein Sequence (575 amino acids)

>Psyr_0634 MORN motif protein (Pseudomonas syringae pv. syringae B728a)
MRALAPLALTLLIAGCGDGESILPPDGRLPDGGRYRGDLVNGVLQGQGRIDYPNGSWFAG
QFENGLRQGQGEWHASNGDVYKGGFEQGLFNGQGRLTTRAGASYVGSFKLGMRDGEGTQK
DKGVLYRGQFKAGVYDGPGRLELEDGSQHQGMFANGKANGEGSRSDASGNQYSGNFIDGQ
LQGTGSFTSAEGDQYVGNFRNSQLDGKGRYENSDGDVWSGEFKEGALTGKGELIGSDGSR
YQGDFDNWRFMGQGQLLLADGSRYVGQFADDTYQGDGVLISPDGKEQRGIWANGERIRDA
KGKLLPDPLEAGLLVQGSLLDKALAAVPASTPATELYTLVVGGDGKQSVFMREADYVSNL
LKSRFGAVGQVSLVNHRDHMDDRPMATRETITRAVQTLAQRTGPEDLVFIYLTSHGTQDH
ELVLDQPRLSLADLPADALAAALAPLKNRDKVVVISACYSGGFIPDLKDERTLIMTASRA
DRVSFGCSEEADFTYFGDALFARALVETDDLQHAFNEAQAYVAQRETEDNFEASEPQIWA
PKGVLARWQQLRKSQAERALSTALNRTEAKTSTSR