Protein Info for Psyr_0631 in Pseudomonas syringae pv. syringae B728a

Annotation: Flavoprotein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 209 PF02441: Flavoprotein" amino acids 6 to 189 (184 residues), 148.1 bits, see alignment E=8.7e-48 TIGR00421: polyprenyl P-hydroxybenzoate and phenylacrylic acid decarboxylases" amino acids 6 to 200 (195 residues), 201 bits, see alignment E=6.6e-64

Best Hits

Swiss-Prot: 81% identical to UBIX_PSEAE: Flavin prenyltransferase UbiX (ubiX) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K03186, 3-octaprenyl-4-hydroxybenzoate carboxy-lyase UbiX [EC: 4.1.1.-] (inferred from 99% identity to pst:PSPTO_0730)

MetaCyc: 81% identical to flavin prenyltransferase (Pseudomonas aeruginosa)
RXN-16937 [EC: 2.5.1.129]

Predicted SEED Role

"3-polyprenyl-4-hydroxybenzoate carboxy-lyase UbiX (EC 4.1.1.-)" in subsystem Ubiquinone Biosynthesis (EC 4.1.1.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.1.1.-

Use Curated BLAST to search for 2.5.1.129 or 4.1.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZYS1 at UniProt or InterPro

Protein Sequence (209 amino acids)

>Psyr_0631 Flavoprotein (Pseudomonas syringae pv. syringae B728a)
MSGPERVTVAMTGASGAPYGLRLLDCLVREDREVHFLISKAAQLVMATETDVRLPPKAMM
MQAFLTEYTGASAGQIRVYGRDDWMSPVASGSGAPSAMVVVPCSTGSLSAIATGACNNLI
ERAADVTLKERRQLILVPREAPYSSIHLEHMLKLSNMGAVILPASPGFYHQPQTIDDLVD
FVVARILNLLNIPQDMLPRWGEHHIGGDE