Protein Info for Psyr_0604 in Pseudomonas syringae pv. syringae B728a

Annotation: 1-deoxy-D-xylulose-5-phosphate synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 630 PF13292: DXP_synthase_N" amino acids 18 to 289 (272 residues), 400.2 bits, see alignment E=1.1e-123 TIGR00204: 1-deoxy-D-xylulose-5-phosphate synthase" amino acids 22 to 626 (605 residues), 876.1 bits, see alignment E=6.9e-268 PF00676: E1_dh" amino acids 130 to 193 (64 residues), 24.2 bits, see alignment E=4e-09 PF02779: Transket_pyr" amino acids 327 to 486 (160 residues), 149 bits, see alignment E=2.9e-47 PF02780: Transketolase_C" amino acids 502 to 618 (117 residues), 98.3 bits, see alignment E=8.1e-32

Best Hits

Swiss-Prot: 100% identical to DXS_PSEU2: 1-deoxy-D-xylulose-5-phosphate synthase (dxs) from Pseudomonas syringae pv. syringae (strain B728a)

KEGG orthology group: K01662, 1-deoxy-D-xylulose-5-phosphate synthase [EC: 2.2.1.7] (inferred from 100% identity to psb:Psyr_0604)

Predicted SEED Role

"1-deoxy-D-xylulose 5-phosphate synthase (EC 2.2.1.7)" in subsystem Isoprenoid Biosynthesis or Pyridoxin (Vitamin B6) Biosynthesis or Thiamin biosynthesis (EC 2.2.1.7)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.2.1.7

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZYU8 at UniProt or InterPro

Protein Sequence (630 amino acids)

>Psyr_0604 1-deoxy-D-xylulose-5-phosphate synthase (Pseudomonas syringae pv. syringae B728a)
MPTTFKEIPRERPVTPLLDRADTPHGLRRLGEAELETLADELRLELLYSVGQTGGHFGAG
LGVIELTIALHYVFDTPDDRLVWDVGHQAYPHKILTGRRARMSTLRQKEGVAAFPRRSES
EYDTFGVGHSSTSISAALGMAIASRLQGSERKSIAVIGDGALTAGMAFEALNHAPEVAAD
MLVILNDNDMSISRNVGGLSNYLAKILSSRTYSSMREGSKKVLSRLPGAWEIARRTEEYA
KGMLVPGTLFEELGWNYIGPIDGHDLPTLIATLRNMRDLKGPQFLHVVTKKGKGFAPAEV
DPIGYHAITKLEPLNAPAAQKKISAPKYSGVFGQWICDMADADARLVGITPAMKEGSDLV
AFSERFPERYFDVAIAEQHAVTLAAGMACEGSKPVVAIYSTFLQRGYDQLIHDVAVQNLD
VLFAIDRAGLVGEDGPTHAGSFDLSYLRCIPGMLVMTPSDENELRKLLSTGYLHTGPAAV
RYPRGTGPNAVIEASLDPLEIGKGVVRRQGQGVAILAFGVQLAEALVVAEKLDATVIDMR
FVKPLDEALVSEAAANHELLVTLEENAVMGGAGAAVSEFLARANILKSVLHLGLPDVYVE
HAKPAQMLTECGLDAQGIEAAINERLALIG