Protein Info for Psyr_0599 in Pseudomonas syringae pv. syringae B728a

Annotation: amino acid/amide ABC transporter membrane protein 2, HAAT family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 437 transmembrane" amino acids 19 to 41 (23 residues), see Phobius details amino acids 53 to 71 (19 residues), see Phobius details amino acids 101 to 118 (18 residues), see Phobius details amino acids 124 to 146 (23 residues), see Phobius details amino acids 153 to 172 (20 residues), see Phobius details amino acids 178 to 198 (21 residues), see Phobius details amino acids 205 to 225 (21 residues), see Phobius details amino acids 271 to 288 (18 residues), see Phobius details amino acids 320 to 343 (24 residues), see Phobius details amino acids 358 to 384 (27 residues), see Phobius details amino acids 395 to 412 (18 residues), see Phobius details PF11862: DUF3382" amino acids 17 to 115 (99 residues), 80.3 bits, see alignment E=1.1e-26 PF02653: BPD_transp_2" amino acids 123 to 408 (286 residues), 168.3 bits, see alignment E=2e-53

Best Hits

KEGG orthology group: K01998, branched-chain amino acid transport system permease protein (inferred from 100% identity to psb:Psyr_0599)

Predicted SEED Role

"Branched-chain amino acid transport system permease protein LivM (TC 3.A.1.4.1)" in subsystem ABC transporter branched-chain amino acid (TC 3.A.1.4.1) (TC 3.A.1.4.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZYV3 at UniProt or InterPro

Protein Sequence (437 amino acids)

>Psyr_0599 amino acid/amide ABC transporter membrane protein 2, HAAT family (Pseudomonas syringae pv. syringae B728a)
MSAPVAVPVSKPVEIKKSLIDAVVAGLLALIVFGPIVGIVLDGYSFNLQPTRVAWLVGVV
MIGRFLISLFLQTPRGLRVSQSFESSDSGVHVLKPDHRSSLYWIIPLLIVIAIVFPIFAN
KYILTVVILGLIYVLLGLGLNIVVGLAGLLDLGYVAFYAIGAYGLALGYQYLGLGFWSAL
PLAAIAAALAGCILGFPVLRMHGDYLAIVTLGFGEIIRLVLNNWLSFTGGPNGVPVPAPT
FLGLEFGRRAKDGGVPIHEYFGFDYNPDLKFIFIYTVLFLVVLAVLFIKHRLTRMPIGRA
WEALREDEIACRSMGLNHVLVKLSAFTIGASTAGLAGVFFASYQGFVNPTSFTFFESALI
LAIVVLGGMGSTVGVVIAAFVLTVAPELLRSFSEYRVLLFGILMVLMMIWRPRGLIRISR
TGVKPRKGALVTERAAR