Protein Info for Psyr_0598 in Pseudomonas syringae pv. syringae B728a

Annotation: amino acid/amide ABC transporter membrane protein 1, HAAT family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 304 transmembrane" amino acids 15 to 36 (22 residues), see Phobius details amino acids 43 to 62 (20 residues), see Phobius details amino acids 68 to 88 (21 residues), see Phobius details amino acids 100 to 119 (20 residues), see Phobius details amino acids 150 to 171 (22 residues), see Phobius details amino acids 200 to 222 (23 residues), see Phobius details amino acids 230 to 263 (34 residues), see Phobius details amino acids 275 to 296 (22 residues), see Phobius details PF02653: BPD_transp_2" amino acids 9 to 288 (280 residues), 160.8 bits, see alignment E=1.9e-51

Best Hits

Swiss-Prot: 56% identical to BRAD_PSEAE: High-affinity branched-chain amino acid transport system permease protein BraD (braD) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K01997, branched-chain amino acid transport system permease protein (inferred from 99% identity to psp:PSPPH_0591)

MetaCyc: 56% identical to branched chain amino acid/phenylalanine ABC transporter membrane subunit LivH (Escherichia coli K-12 substr. MG1655)
ABC-15-RXN [EC: 7.4.2.2]; 7.4.2.2 [EC: 7.4.2.2]; 7.4.2.2 [EC: 7.4.2.2]; 7.4.2.2 [EC: 7.4.2.2]

Predicted SEED Role

"High-affinity branched-chain amino acid transport system permease protein LivH (TC 3.A.1.4.1)" in subsystem ABC transporter branched-chain amino acid (TC 3.A.1.4.1) (TC 3.A.1.4.1)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.4.2.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZYV4 at UniProt or InterPro

Protein Sequence (304 amino acids)

>Psyr_0598 amino acid/amide ABC transporter membrane protein 1, HAAT family (Pseudomonas syringae pv. syringae B728a)
MDGIFLQQMVNGLTLGSVYGLIAIGYTMVYGIIGMINFAHGDVYMISAYLAAIGLAVLSF
FGVESFPFLILGTLVFTIVVTGVYGFVIERVAYKPLRNSTRLAPLISAIGISLILQNYAQ
ISQGARQQGVPTLLEGAWRFEVGSGFVQITYTKIFILIAAFVGMGVLTYIIKYTKLGRMC
RATQQDRKMASILGINTDRVISYVFIIGAAMAALAGVLITMNYGTFDFYAGFIIGIKAFT
AAVLGGIGSLPGAMLGGLILGVAESQFSGLINSDYKDVFSFGLLVLILIFRPQGLLGRPL
VAKV