Protein Info for Psyr_0597 in Pseudomonas syringae pv. syringae B728a

Annotation: amino acid/amide ABC transporter substrate-binding protein, HAAT family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 378 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details PF13433: Peripla_BP_5" amino acids 29 to 372 (344 residues), 61.1 bits, see alignment E=1.6e-20 PF13458: Peripla_BP_6" amino acids 29 to 370 (342 residues), 211.7 bits, see alignment E=3.5e-66 PF01094: ANF_receptor" amino acids 51 to 366 (316 residues), 87.8 bits, see alignment E=1.2e-28

Best Hits

Swiss-Prot: 50% identical to LIVB1_BRUSU: Leu/Ile/Val-binding protein homolog 1 (BR1785) from Brucella suis biovar 1 (strain 1330)

KEGG orthology group: K01999, branched-chain amino acid transport system substrate-binding protein (inferred from 100% identity to psb:Psyr_0597)

MetaCyc: 42% identical to L-leucine/L-phenylalanine ABC transporter periplasmic binding protein (Escherichia coli K-12 substr. MG1655)
ABC-35-RXN [EC: 7.4.2.2]; 7.4.2.2 [EC: 7.4.2.2]

Predicted SEED Role

"Branched-chain amino acid ABC transporter, amino acid-binding protein (TC 3.A.1.4.1)" in subsystem ABC transporter branched-chain amino acid (TC 3.A.1.4.1) (TC 3.A.1.4.1)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.4.2.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZYV5 at UniProt or InterPro

Protein Sequence (378 amino acids)

>Psyr_0597 amino acid/amide ABC transporter substrate-binding protein, HAAT family (Pseudomonas syringae pv. syringae B728a)
MSHTFYRKGFLAIAVATALGVSSFAQADVKIGVAGPMTGANASFGQQYMKGAQAAADAIN
AAGGVNGEKIVLIAGDDACEPKQAVAVANRLVDQDKVIGVVGHFCSSSTIPASEIYDEAG
VIAITPGSTNPTVTERGLKDMFRMCGRDDQQGVVAGDYIVDVLKGKKVAVINDKDTYGKG
LADATAAQLTKRGVEPILEEGLTRGEKDFSALVTKIRSVDADVVYFGGLHPEAGPLVRQM
REQGLKDVKFMSDDGVVTDELVTTAGGAQYVDGVYMTFGADPRALPDSKAVVDQFRKAGY
EPEGYTLYAYASVQALAAGFNGAKSNKGDAAATWLKANPVKTVMGEKAWDAKGDLKVSDY
VVYQWDAAGKYKQLEKQK