Protein Info for Psyr_0589 in Pseudomonas syringae pv. syringae B728a

Annotation: protein of unknown function DUF403:Protein of unknown function DUF404:Protein of unknown function DUF407

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 831 transmembrane" amino acids 638 to 654 (17 residues), see Phobius details amino acids 675 to 692 (18 residues), see Phobius details PF04174: CP_ATPgrasp_1" amino acids 81 to 412 (332 residues), 364.8 bits, see alignment E=5.8e-113 PF14403: CP_ATPgrasp_2" amino acids 81 to 459 (379 residues), 519.1 bits, see alignment E=1e-159 PF04168: Alpha-E" amino acids 509 to 818 (310 residues), 219.4 bits, see alignment E=1.4e-68

Best Hits

KEGG orthology group: None (inferred from 100% identity to psb:Psyr_0589)

Predicted SEED Role

"Protein containing domains DUF404, DUF407, DUF403"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZYW3 at UniProt or InterPro

Protein Sequence (831 amino acids)

>Psyr_0589 protein of unknown function DUF403:Protein of unknown function DUF404:Protein of unknown function DUF407 (Pseudomonas syringae pv. syringae B728a)
MPDLLDHYPLSEGTYHEMLDADGAVRPHWRRLYEHMRRSSAAQLIQRQALLTRQIQENGV
TYNVYADPKGADRPWELDLLPHIIAADEWQHVAAGIAQRARLLNAVLADLYGPQTLIANG
LLPAELVFGHNNFLWPCQGVKPPEGTFLHMYAVDLARTPDGRWWVTADRTQAPSGAGYAL
ENRQSVARALPETYRDLQVRHLSGFFDALQQTLARQAPTSNEAPLIVLLTPGRFNESYFE
HLYLARQLGYPLVEGGDLTVRDATVYLKTLSGLRRVHAIMRRLDDDFCDPLELRTDSALG
VPGLLEAVRQGNVLVANALGSGVLESPGLLGFLPKISQYLFGEDLILPSVATWWCGEPPV
LAQALEKLPDLLIKPAFPSQHFAPVFGRDLNEEQRLALAQRMQSRPYAYVAQELAQLSHA
PVLQADGTGLQPRAIGMRVYAVASLDGYRVLPGGLTRVAAEADADVVSMQRGGASKDTWV
LGERSHLGEPWKGQRKLGVYDLIRRDPYLPSRVVENLFWFGRYCERCDDSARLLRIMLTR
YVDDDDPLALQAAVALAESLGMLPEAQEGEELRDRLLVALMGDEWPFSLRANLQRLQWAA
SQVRGKLSKENWQALVELQREALSLESEEPDFGELLDFLNRLVMSLAALSGFAMDDMTRD
EGWSFLMIGRRIERLKFLSTSLSAFLRGLVVFERAGLEWLLELGNSSITYRSRYMAVPHL
IPVLDLLLLDEQNPHAVLFQLKLVQRSLRRLNDEFDAPRDSSLAVLAQRLAAFDLGSLEN
PLFGQSSIDAVLDGLADLLQSIGDCSGQASDRLALRHFAHVDDVSQRTVSV