Protein Info for Psyr_0577 in Pseudomonas syringae pv. syringae B728a

Annotation: Adenylosuccinate synthetase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 430 TIGR00184: adenylosuccinate synthase" amino acids 6 to 429 (424 residues), 610.1 bits, see alignment E=1e-187 PF00709: Adenylsucc_synt" amino acids 6 to 423 (418 residues), 609.6 bits, see alignment E=1.3e-187

Best Hits

Swiss-Prot: 100% identical to PURA_PSEU2: Adenylosuccinate synthetase (purA) from Pseudomonas syringae pv. syringae (strain B728a)

KEGG orthology group: K01939, adenylosuccinate synthase [EC: 6.3.4.4] (inferred from 99% identity to pst:PSPTO_4937)

MetaCyc: 70% identical to adenylosuccinate synthetase (Escherichia coli K-12 substr. MG1655)
Adenylosuccinate synthase. [EC: 6.3.4.4]

Predicted SEED Role

"Adenylosuccinate synthetase (EC 6.3.4.4)" in subsystem CBSS-262719.3.peg.410 or Purine conversions (EC 6.3.4.4)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.4.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZYX5 at UniProt or InterPro

Protein Sequence (430 amino acids)

>Psyr_0577 Adenylosuccinate synthetase (Pseudomonas syringae pv. syringae B728a)
MGKNVVVLGTQWGDEGKGKIVDLLTEHATAVVRYQGGHNAGHTLVIDGEKTVLHLIPSGV
LREGVQCLIGNGVVVAPDALLREIVKLEEKGIPVRERLRISPSCPLILSYHVALDQAREK
ARGEFKIGTTGRGIGPAYEDKVARRGLRIGDLFHRERFAAKLGELLDYHNFVLVNYYKEP
AIDFQKTLDECMEYADMLKPLMLDVTAALHEMRRDGKDIMFEGAQGSLLDIDHGTYPYVT
SSNTTAGGIATGSGFGPMYLDYILGITKAYTTRVGSGPFPTELFDDVGAFLAKRGHEFGA
TTGRARRCGWFDAVILRRAIEINSISGLCLTKLDVLDGLETINICVGYENEEGAVIDAPT
DADSYLGLRPVYEQMPGWSESTLGAKTLEELPAAARAYIKRVEELVGAPIDIISTGPDRN
ETIVLRHPFG