Protein Info for Psyr_0571 in Pseudomonas syringae pv. syringae B728a

Annotation: tRNA isopentenyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 323 signal peptide" amino acids 1 to 17 (17 residues), see Phobius details TIGR00174: tRNA dimethylallyltransferase" amino acids 7 to 304 (298 residues), 330.9 bits, see alignment E=3.2e-103 PF01715: IPPT" amino acids 41 to 294 (254 residues), 302.8 bits, see alignment E=2e-94

Best Hits

Swiss-Prot: 100% identical to MIAA_PSEU2: tRNA dimethylallyltransferase (miaA) from Pseudomonas syringae pv. syringae (strain B728a)

KEGG orthology group: K00791, tRNA dimethylallyltransferase [EC: 2.5.1.75] (inferred from 100% identity to psb:Psyr_0571)

Predicted SEED Role

"tRNA dimethylallyltransferase (EC 2.5.1.75)" (EC 2.5.1.75)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.5.1.75

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZYY1 at UniProt or InterPro

Protein Sequence (323 amino acids)

>Psyr_0571 tRNA isopentenyltransferase (Pseudomonas syringae pv. syringae B728a)
MNALPPAIFLMGPTAAGKTDLAIELTKVLPCELISVDSALVYRGMDIGTAKPSKTQLAEH
PHRLIDILDPAQSYSAADFRSDALAAMAEITARGNIPLLVGGTMLYFKALLDGLADMPAA
DAQVRAQLEADAQAFGWQALHDQLAVVDPVSAARIHPNDPQRLIRALEVYRVSGMSMTAH
REQQTAQSTEAAASGRQQLPYTVANLAIAPADRKVLHQRIALRFEQMLDQGFLDEVLALR
SRGDLHSGLPSIRAVGYRQVWDHLDGKLTRDEMQERGIIATRQLAKRQFTWLRSWDDLHW
LDSLASDNLSRALKYLGSVSILS