Protein Info for Psyr_0570 in Pseudomonas syringae pv. syringae B728a

Annotation: DNA mismatch repair protein MutL

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 648 TIGR00585: DNA mismatch repair protein MutL" amino acids 22 to 330 (309 residues), 339.7 bits, see alignment E=1.1e-105 PF02518: HATPase_c" amino acids 41 to 97 (57 residues), 27 bits, see alignment 1.1e-09 PF13589: HATPase_c_3" amino acids 44 to 145 (102 residues), 44 bits, see alignment E=4.8e-15 PF01119: DNA_mis_repair" amino acids 233 to 349 (117 residues), 137.2 bits, see alignment E=4.1e-44 PF08676: MutL_C" amino acids 462 to 604 (143 residues), 166.2 bits, see alignment E=7.4e-53

Best Hits

Swiss-Prot: 95% identical to MUTL_PSESM: DNA mismatch repair protein MutL (mutL) from Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)

KEGG orthology group: K03572, DNA mismatch repair protein MutL (inferred from 100% identity to psb:Psyr_0570)

Predicted SEED Role

"DNA mismatch repair protein MutL" in subsystem DNA repair, bacterial MutL-MutS system

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZYY2 at UniProt or InterPro

Protein Sequence (648 amino acids)

>Psyr_0570 DNA mismatch repair protein MutL (Pseudomonas syringae pv. syringae B728a)
MTDLLLDGAEADNAQTALNAARIELLSPRLANQIAAGEVVERPASVIKELLENSLDSGAR
RIDVDVEQAGIKLLKVRDDGSGISSDDLPLALARHATSKIRDLEDLERVMSLGFRGEALA
SISSVARLTLTSRTRDADQAWQVETEGRDMAPRVQPAAHPVGTSVEVRDLFFNTPARRKF
LKAEKTEFDHLQEVIKRMALARFDVAFHLRHNGKTVLSLHEAHDDTARARRVSAICGPGF
LEQALPIEIERNGLHLWGWVGLPTFSRSQADLQYFFVNGRAVRDKLVAHAVRQAYRDVLF
NGRHPTFVLFFEVDPAAVDVNVHPTKHEVRFRDGRMVHDFLYGTLYRALGDVRPENQLGG
SVPVVAEARPSGPEAGEFGPQGEMRLANNVLEQPQGEPFARPAAGGGAGSGYQYQYTPRP
TAGVPVAEAQSAYREFFAPLPSAASASLPESPGDIPPLGYALAQLKGIYILAENAHGLVL
VDMHAAHERIMYERLKIAMANEGLSGQPLLVPESIAVSQREADCAEEHLATFQRLGFELQ
RLGPETLAIRQIPALLKQAEANRLVSDVLADLMEYGTSDRVQAHMNELLGTMACHGAIRA
NRRLAIPEMNGLLRDMENTERSGQCNHGRPTWTQMGLNDLDKLFLRGQ