Protein Info for Psyr_0565 in Pseudomonas syringae pv. syringae B728a

Annotation: Protein of unknown function UPF0126

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 203 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details transmembrane" amino acids 63 to 80 (18 residues), see Phobius details amino acids 87 to 108 (22 residues), see Phobius details amino acids 114 to 135 (22 residues), see Phobius details amino acids 147 to 166 (20 residues), see Phobius details amino acids 172 to 190 (19 residues), see Phobius details PF03458: Gly_transporter" amino acids 4 to 78 (75 residues), 80.6 bits, see alignment E=3.2e-27 amino acids 90 to 163 (74 residues), 80.7 bits, see alignment E=2.9e-27

Best Hits

Swiss-Prot: 56% identical to YICG_ECOLI: UPF0126 inner membrane protein YicG (yicG) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to psb:Psyr_0565)

Predicted SEED Role

"putative membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZYY7 at UniProt or InterPro

Protein Sequence (203 amino acids)

>Psyr_0565 Protein of unknown function UPF0126 (Pseudomonas syringae pv. syringae B728a)
MLLMLYLIAITAEAMTGALSAGRRGMDWFGVVLIACVTALGGGSVRDVLIGHYPLTWVKH
PEYLVLTSVAALVTIFIAPLMRHLRSLFLVLDALGLVAFTLIGCMTALEAGHGLLIASVC
GVITGVFGGILRDIFCNDIPLIFRRELYASVSFLAAWCFLLCQYLQLPDEQAVLITLFGG
LLLRLLAIRFRWEMPKFVYKDEP