Protein Info for Psyr_0561 in Pseudomonas syringae pv. syringae B728a

Annotation: chemotaxis motA protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 283 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details transmembrane" amino acids 32 to 55 (24 residues), see Phobius details amino acids 170 to 191 (22 residues), see Phobius details amino acids 198 to 221 (24 residues), see Phobius details TIGR03818: flagellar motor stator protein MotA" amino acids 1 to 281 (281 residues), 362.2 bits, see alignment E=8e-113 PF20560: MotA_N" amino acids 4 to 92 (89 residues), 94.2 bits, see alignment E=4.8e-31 PF01618: MotA_ExbB" amino acids 135 to 239 (105 residues), 42.6 bits, see alignment E=5e-15

Best Hits

Swiss-Prot: 36% identical to MOTA_RHIME: Motility protein A (motA) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K02556, chemotaxis protein MotA (inferred from 99% identity to pst:PSPTO_4953)

Predicted SEED Role

"Flagellar motor rotation protein MotA" in subsystem Flagellar motility or Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZYZ1 at UniProt or InterPro

Protein Sequence (283 amino acids)

>Psyr_0561 chemotaxis motA protein (Pseudomonas syringae pv. syringae B728a)
MAKIIGIIVVLASVIGGYVLSHGKVMALFQPYEVLIIGGAALGAFLQANPGYMFMHVFKK
SLKMFGTRFTHAYYLEVLGLVYEILNKSRREGMMAIEGDIEDAASSPIFAKYPGVLKDER
MTAYICDYLRIMSSGNMAPHELEGLFDMELLSMKEDLEHPSHAITGIADGMPGFGIVAAV
LGIVVTMASLGSGDKAAIGMHVGAALVGTFFGILAAYGFFGPLATSLAHDAKEEMNVYES
IKASLVASASGMPPSLAVEFGRKVLYPLHRPSFSELEQAVRGR