Protein Info for Psyr_0557 in Pseudomonas syringae pv. syringae B728a

Annotation: phosphoserine phosphatase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 418 PF13740: ACT_6" amino acids 17 to 92 (76 residues), 90.3 bits, see alignment E=1.8e-29 PF01842: ACT" amino acids 20 to 78 (59 residues), 30.6 bits, see alignment E=6.8e-11 PF21086: ACT_PSP_2" amino acids 112 to 194 (83 residues), 33.6 bits, see alignment E=1e-11 TIGR00338: phosphoserine phosphatase SerB" amino acids 191 to 409 (219 residues), 270.7 bits, see alignment E=8.8e-85 TIGR01488: HAD phosphoserine phosphatase-like hydrolase, family IB" amino acids 206 to 376 (171 residues), 116.2 bits, see alignment E=1.7e-37 PF00702: Hydrolase" amino acids 206 to 378 (173 residues), 89.1 bits, see alignment E=1.6e-28 PF12710: HAD" amino acids 207 to 374 (168 residues), 94.2 bits, see alignment E=4.3e-30 PF08282: Hydrolase_3" amino acids 342 to 408 (67 residues), 43.6 bits, see alignment E=9.8e-15

Best Hits

KEGG orthology group: K01079, phosphoserine phosphatase [EC: 3.1.3.3] (inferred from 100% identity to psb:Psyr_0557)

Predicted SEED Role

"Phosphoserine phosphatase (EC 3.1.3.3)" in subsystem Glycine and Serine Utilization or Serine Biosynthesis (EC 3.1.3.3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.1.3.3

Use Curated BLAST to search for 3.1.3.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZYZ5 at UniProt or InterPro

Protein Sequence (418 amino acids)

>Psyr_0557 phosphoserine phosphatase (Pseudomonas syringae pv. syringae B728a)
MWLECVFFPLRGCALREIVLINITGVDRPGLTAAITGVLAQGGVNILDIGQAVIHDTLSF
GILVEIPDTVQGSSVLKDILFTAYELDQQVRFTAVSETDYQHWVEGQGKARHIVTLLTRK
VTAEQLQRVSAITARYGLNIDQIDRLSGRMPLDTPADKGKGCIEFTVRGEPADPKAMQAE
FLAVAQDLDVDIAFQQDSLFRRNRRLAVFDMDSTLIEAEVIDELAKAAGVGEQVSEITER
AMRGELDFSESFKERLALLKGLDVSVLDEIGASLRLTEGAETLFSELKRLGYKTAILSGG
FTYFAKQLQAKLGIDYVFANELEVVDGKVTGVAVEPIVNAQRKADLLRELAHKEGLSLEQ
TIAVGDGANDLPMLAIAGLGVAFRAKPLVKQSAKQAISTLGLDGVLYLLGLRDREGKR