Protein Info for Psyr_0545 in Pseudomonas syringae pv. syringae B728a

Annotation: Permease for cytosine/purines, uracil, thiamine, allantoin

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 429 transmembrane" amino acids 26 to 48 (23 residues), see Phobius details amino acids 55 to 76 (22 residues), see Phobius details amino acids 96 to 118 (23 residues), see Phobius details amino acids 140 to 162 (23 residues), see Phobius details amino acids 169 to 186 (18 residues), see Phobius details amino acids 205 to 224 (20 residues), see Phobius details amino acids 236 to 261 (26 residues), see Phobius details amino acids 269 to 289 (21 residues), see Phobius details amino acids 316 to 335 (20 residues), see Phobius details amino acids 340 to 362 (23 residues), see Phobius details amino acids 374 to 393 (20 residues), see Phobius details amino acids 399 to 420 (22 residues), see Phobius details PF02133: Transp_cyt_pur" amino acids 12 to 370 (359 residues), 87.7 bits, see alignment E=3.9e-29 TIGR02358: putative hydroxymethylpyrimidine transporter CytX" amino acids 23 to 414 (392 residues), 420.9 bits, see alignment E=2.8e-130

Best Hits

KEGG orthology group: K03457, nucleobase:cation symporter-1, NCS1 family (inferred from 100% identity to psb:Psyr_0545)

Predicted SEED Role

"Predicted hydroxymethylpyrimidine transporter CytX" in subsystem Thiamin biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZZ07 at UniProt or InterPro

Protein Sequence (429 amino acids)

>Psyr_0545 Permease for cytosine/purines, uracil, thiamine, allantoin (Pseudomonas syringae pv. syringae B728a)
MNTPGTYSPDTPVPASQRVFGGRDLFSLWFSLGIGLMVLQTGALLAPGLGMSGSMLAIFL
GTLAGVLLLASVGVIGSDTGLSSMAALKLSLGSKGASLPAVLNLLQLIGWGAFEIIVMRD
AASLLGARAFAEGSLWSSPLLWTLLFGALATLLAVSGPLTFVRRFLRKWGLWILLTACAW
LTWNLLAKADLTALWATSGDGSLPFASGFDIAIAMPLSWLPLIADYSRFGQRAKSVFGGT
AAGFFIGNFWLMSLGVAYTLAFAPSGEVNALLLALAGAGLGIPLLLILLDETENAFADIH
SAAVSSALLSRIKVEHLALVIGVICTLIACLAPLAQYQNFLLLIGSVFAPLFGVVLVDHF
ILRGRSGQAAEGGLRWMSLLAWLGGLSTYHLLANLYPEVGATLPALIVAGVLQLLIGGAI
NRGRGTVPA