Protein Info for Psyr_0544 in Pseudomonas syringae pv. syringae B728a

Annotation: hydroxymethylpyrimidine synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 629 transmembrane" amino acids 473 to 491 (19 residues), see Phobius details PF13667: ThiC-associated" amino acids 24 to 101 (78 residues), 109.8 bits, see alignment E=4.5e-36 TIGR00190: phosphomethylpyrimidine synthase" amino acids 140 to 592 (453 residues), 715.5 bits, see alignment E=9.5e-220 PF01964: ThiC_Rad_SAM" amino acids 142 to 590 (449 residues), 608.3 bits, see alignment E=7e-187

Best Hits

Swiss-Prot: 100% identical to THIC_PSEU2: Phosphomethylpyrimidine synthase (thiC) from Pseudomonas syringae pv. syringae (strain B728a)

KEGG orthology group: K03147, thiamine biosynthesis protein ThiC (inferred from 100% identity to psb:Psyr_0544)

MetaCyc: 72% identical to phosphomethylpyrimidine synthase (Escherichia coli K-12 substr. MG1655)
PYRIMSYN1-RXN [EC: 4.1.99.17]

Predicted SEED Role

No annotation

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.99.17

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZZ08 at UniProt or InterPro

Protein Sequence (629 amino acids)

>Psyr_0544 hydroxymethylpyrimidine synthase (Pseudomonas syringae pv. syringae B728a)
MSIKAKNAAHLRESAQVDSGSVQPFTRSQKIYVQGSRPDIRVPMREITLDVTPTDFGGEI
NAPVTVYDTSGPYTDPNVIIDVRKGLADVRSPWIDSRNDTERLPGLSSNFGQQRLSDAEL
TALRFAHVRNPRRAKAGANVSQMHYARQGIITAEMEYVAIRENMKLQEARAAGLLTQQHA
GHSFGASIPKEITAEFVREEIARGRAIIPANINHVELEPMIIGRNFLVKINGNIGNSALG
SSIEEEVAKLTWGIRWGSDTVMDLSTGKHIHETREWIIRNSPVPIGTVPIYQALEKVGGA
AEDLTWELFRDTLIEQAEQGVDYFTIHAGVLLRYVPLTAKRVTGIVSRGGSIMAKWCLAH
HKENFLYTHFEDICEIMKAYDVSFSLGDGLRPGSIADANDAAQFGELETLGELTKIAWKH
DVQTMIEGPGHVPMQLIKENMDKQLECCDEAPFYTLGPLTTDIAPGYDHITSGIGAAMIG
WFGCAMLCYVTPKEHLGLPNKDDVKTGIITYKIAAHAADLAKGHPGAQIRDNALSKARFE
FRWEDQFNLGLDPDTARSYHDETLPKDSAKVAHFCSMCGPKFCSMKITQEVREYAANQRI
EAVDVDVAKGLAEQAERFKQEGSQLYKKV