Protein Info for Psyr_0509 in Pseudomonas syringae pv. syringae B728a

Annotation: PAS:GGDEF

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 719 PF00072: Response_reg" amino acids 23 to 134 (112 residues), 85.7 bits, see alignment E=7.4e-28 PF13188: PAS_8" amino acids 162 to 212 (51 residues), 23 bits, see alignment 1.7e-08 PF00989: PAS" amino acids 163 to 211 (49 residues), 29.6 bits, see alignment 1.8e-10 TIGR00229: PAS domain S-box protein" amino acids 163 to 268 (106 residues), 28.3 bits, see alignment E=1.7e-10 PF24820: Diguanyl_cycl_sensor" amino acids 167 to 265 (99 residues), 31.6 bits, see alignment E=4.4e-11 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 279 to 442 (164 residues), 144.4 bits, see alignment E=2.7e-46 PF00990: GGDEF" amino acids 283 to 440 (158 residues), 149.5 bits, see alignment E=2.3e-47 PF00563: EAL" amino acids 460 to 695 (236 residues), 230.1 bits, see alignment E=7.4e-72

Best Hits

KEGG orthology group: None (inferred from 100% identity to psb:Psyr_0509)

Predicted SEED Role

"Sensory box/GGDEF family protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZZ43 at UniProt or InterPro

Protein Sequence (719 amino acids)

>Psyr_0509 PAS:GGDEF (Pseudomonas syringae pv. syringae B728a)
MPTQRSSMERVPNQPDDGSSVLLVVDDYPENLVTMCAVLQRTDWHIVTASSGIEALTVLL
EQEVDLVLLDVQMPGMDGFEVARLMRGSQRTRLTPIIFLTANEQTQDAVQKGYANGATDY
LFKPFDPNVLKPKVQTLLEQQRNRRALQQLSLELESARAFNASVLANVAEGILVVDEAGT
ISFANPAICQLLNTSVDHLRGTQVLDYIIEPKVGHWLDSGFYQHYRKSDTYRVHDAILRT
AQGTQLPVALSCAALPAEQKAMVLTVLDMSVVRDLYQQLEKQAVTDALTGLLNRRGLYQA
VESMLLRNERADKYLVVLFMDLDGFKQINDTLGHEAGDQVLLWVAEQFKDSMRPYDVLAR
IGGDEFTVVIDGLDYPEQAAKIAEKLIERVSGRRQVDGVEITLGASVGIATFPDCGSNLD
GLLRAADIAMYEAKRAGRQQYRFYDQNMNGRARSRLMLEESVRTAIDGRDFSVVYQPQIH
VADGRLRGFEALLRWQHPAVGEVPPALFIPLLEETRLINRLGSWIFDQGAEQRQAWSHIF
APDMVLSVCVSPTQFCLPNLASELKRAMDRFELKPGQIEVEITETALVNNLTHSHKQLKL
LHEVGVRIALDDFGTGECSLSHLRNLQLDTLKLDRRFVANIAGSKREAAMASSIIDLSRN
LDMLVIAEGVETAEQYQWLADNGCQVMQGFLIAHPMLPEDALRFPGHFDVAGFRQTRLL