Protein Info for Psyr_0507 in Pseudomonas syringae pv. syringae B728a

Annotation: Na+/solute symporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 519 transmembrane" amino acids 31 to 50 (20 residues), see Phobius details amino acids 65 to 86 (22 residues), see Phobius details amino acids 92 to 94 (3 residues), see Phobius details amino acids 100 to 117 (18 residues), see Phobius details amino acids 148 to 175 (28 residues), see Phobius details amino acids 187 to 208 (22 residues), see Phobius details amino acids 217 to 236 (20 residues), see Phobius details amino acids 256 to 275 (20 residues), see Phobius details amino acids 299 to 321 (23 residues), see Phobius details amino acids 349 to 373 (25 residues), see Phobius details amino acids 395 to 415 (21 residues), see Phobius details amino acids 427 to 446 (20 residues), see Phobius details amino acids 453 to 471 (19 residues), see Phobius details amino acids 477 to 497 (21 residues), see Phobius details TIGR02121: sodium/proline symporter" amino acids 31 to 513 (483 residues), 730.6 bits, see alignment E=8.6e-224 PF00474: SSF" amino acids 59 to 461 (403 residues), 449.6 bits, see alignment E=5e-139 TIGR00813: transporter, solute:sodium symporter (SSS) family" amino acids 59 to 461 (403 residues), 387.5 bits, see alignment E=8.3e-120

Best Hits

Swiss-Prot: 75% identical to PUTP_ECOLI: Sodium/proline symporter (putP) from Escherichia coli (strain K12)

KEGG orthology group: K11928, sodium/proline symporter (inferred from 100% identity to psb:Psyr_0507)

MetaCyc: 75% identical to proline:Na+ symporter (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-118; TRANS-RXN0-505

Predicted SEED Role

"Proline/sodium symporter PutP (TC 2.A.21.2.1) @ Propionate/sodium symporter" (TC 2.A.21.2.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZZ45 at UniProt or InterPro

Protein Sequence (519 amino acids)

>Psyr_0507 Na+/solute symporter (Pseudomonas syringae pv. syringae B728a)
MCRISVAIPFGIGCQHKNNAKAELMSVSNPTLITFVIYIAAMVLIGLMAYRSTNNLSDYI
LGGRSLGSVVTALSAGASDMSGWLLMGLPGAIYMSGLSESWIAIGLIIGAYLNWLFVAGR
LRVQTEHNGDALTLPDYFSSRFEDNSGLLRIISAIVILVFFTIYCASGIVAGARLFESTF
GMSYETALWAGAAATIAYTFVGGFLAVSWTDTVQATLMIFALILTPVIVLLATGGVDTTF
LAIEAKDPTSFDMFKNTTFIGIISLLGWGLGYFGQPHILARFMAADSVKSIASARRISMA
WMILCLGGTVAVGFFGIAYFSAHPEVAGPVTENPERVFIELAKLLFNPWIAGVLLSAILA
AVMSTLSCQLLVCSSALTEDFYKAYLRKGASQVELVWVGRAMVLLIAIIAILLAANPENR
VLGLVSYAWAGFGAAFGPVVLISVLWKGMTRNGALAGVIMGAATVVLWKQFSTMGLYEII
PGFILASISIVVFSLIGKPASASMQTRFLAAEQDFKANR