Protein Info for Psyr_0494 in Pseudomonas syringae pv. syringae B728a

Annotation: Protein of unknown function UPF0061

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 487 PF02696: SelO" amino acids 6 to 456 (451 residues), 488.2 bits, see alignment E=1.3e-150

Best Hits

Swiss-Prot: 100% identical to SELO_PSEU2: Protein adenylyltransferase SelO (selO) from Pseudomonas syringae pv. syringae (strain B728a)

KEGG orthology group: None (inferred from 100% identity to psb:Psyr_0494)

MetaCyc: 51% identical to protein adenylyltransferase SelO (Escherichia coli K-12 substr. MG1655)
RXN0-7371 [EC: 2.7.7.108]

Predicted SEED Role

"Selenoprotein O and cysteine-containing homologs"

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.7.108

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZZ58 at UniProt or InterPro

Protein Sequence (487 amino acids)

>Psyr_0494 Protein of unknown function UPF0061 (Pseudomonas syringae pv. syringae B728a)
MKALDELIFDNRFARLGDAFSTSVLPEPIDAPQLVVASQSALALLDLAPEQADLPLFAEI
FSGHKLWSEAEPRAMVYSGHQFGSYNPRLGDGRGLLLGEVYNDAGEHWDLHLKGAGRTPY
SRMGDGRAVLRSSIREFLASEVLHALGIPSSRAGCVVSSSTPVWRETQEHAAMVLRLAQS
HVRFGSLEYFFYTKQPEQLKTLAEHVLTMHYPHCQEQPEPYLAMFREIVERNAELIAKWQ
AYGFCHGVMNTDNMSILGITFDFGPFAFLDDFDEHFICNHSDHEGRYSFSNQVPIAQWNL
SALAQALTPFISVDALREAIGLFLPLYQAHYLDLMRRRLGLTVAHEQDEQLVSQLLKLMQ
NSGVDYTLFFRRLGDQPAAEALRTLRDDFVDIKGFDGWAQAYQARIALENNGTEQERQTR
MHAVNPLYILRNYLAQNAIAAAEKGDYAEVRRLHQVLCTPFTEQPGMQGYAQRPPDWGKH
LEISCSS