Protein Info for Psyr_0491 in Pseudomonas syringae pv. syringae B728a

Annotation: chemotaxis sensory transducer

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 680 transmembrane" amino acids 17 to 38 (22 residues), see Phobius details amino acids 309 to 330 (22 residues), see Phobius details PF13675: PilJ" amino acids 37 to 146 (110 residues), 92.2 bits, see alignment E=2.3e-30 PF00015: MCPsignal" amino acids 456 to 639 (184 residues), 143.8 bits, see alignment E=5e-46

Best Hits

Swiss-Prot: 78% identical to PILJ_PSEAE: Protein PilJ (pilJ) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K02660, twitching motility protein PilJ (inferred from 100% identity to psb:Psyr_0491)

Predicted SEED Role

"type IV pilus biogenesis protein PilJ"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZZ61 at UniProt or InterPro

Protein Sequence (680 amino acids)

>Psyr_0491 chemotaxis sensory transducer (Pseudomonas syringae pv. syringae B728a)
MSSTDRSREGARSRTQIILLFVALIVFIMLLFANFAYLNTQSNYDKQYIGHAGELRVLSQ
RIAKNATEAAAGKTQAFKLLADARNDFDVRWGYLRKGDPATGLPAAPELIRDELRTVQRD
WEGLRKSTDVILASEQTVLSLHQVAATLAETIPQLQAEYEKVVESLLQSRAPAAQVVVAQ
RQALLAERILGSVNTVLAGDETAVQAADAFGRDASQFGRVLNGMLEGNATLRISQVEDRD
ARARLAEIAELFEFVSGSVDEILETSPELYQVREASGNIFNTSQTLLDETSVLANSLENL
AKRRTVNTVGGYVLGLLALASIILIGLVMVRETNRQLRETAQKSERNQTAIMRLLDEIEN
LADGDLTVTASVTEDFTGAIADSINYSIDQLRELVVTINLTAEQVAAAVTETQATAMQLS
AASEHQALQISAASTAINDMAASIDQVSTNASESSAVAERSVTIANKGNEVVQNTIHGMD
NIREQIQDTSKRIKRLGESSQEIGDIVSLIDDIADQTNILALNAAIQASMAGDAGRGFAV
VADEVQRLAERSSSATKQIETLVRAIQNDTNEAVISMEQTTSEVVRGARLAQDAGVALGE
IEGVSRVLAELIESITDAAHQQAESAGQISQIMTVIQQTTSQTTSGTSATAESIGNLAKM
ASEMRRSVSGFALPSSKKAG