Protein Info for Psyr_0485 in Pseudomonas syringae pv. syringae B728a

Annotation: Protein of unknown function DUF179

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 190 PF02622: DUF179" amino acids 18 to 177 (160 residues), 158.5 bits, see alignment E=6.5e-51

Best Hits

Swiss-Prot: 100% identical to Y485_PSEU2: UPF0301 protein Psyr_0485 (Psyr_0485) from Pseudomonas syringae pv. syringae (strain B728a)

KEGG orthology group: K07735, putative transcriptional regulator (inferred from 100% identity to psb:Psyr_0485)

Predicted SEED Role

"UPF0301 protein YqgE"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZZ67 at UniProt or InterPro

Protein Sequence (190 amino acids)

>Psyr_0485 Protein of unknown function DUF179 (Pseudomonas syringae pv. syringae B728a)
MKKVSPSYLKHHFLIAMPHMHDENFAQTLTYIVEHNANGAMGLVINRPQSLTLADVLEQL
RPELPAPRHCQDIVIHTGGPVQTDRGFVLHPSGQTFQATVNLPGGISLSTSQDVLFSIAD
GYGPDQNVITLGYAGWDAGQLDAEMADNAWLTCSFDPAILFDVDSDQRLEAAARRLGINL
NLISTQAGHA