Protein Info for Psyr_0476 in Pseudomonas syringae pv. syringae B728a

Annotation: pyrroline-5-carboxylate reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 272 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details PF01408: GFO_IDH_MocA" amino acids 5 to 81 (77 residues), 24.5 bits, see alignment E=9.5e-09 PF03807: F420_oxidored" amino acids 5 to 99 (95 residues), 73.5 bits, see alignment E=4.3e-24 PF03446: NAD_binding_2" amino acids 5 to 96 (92 residues), 24.1 bits, see alignment E=8e-09 TIGR00112: pyrroline-5-carboxylate reductase" amino acids 6 to 266 (261 residues), 259.7 bits, see alignment E=1.8e-81 PF01210: NAD_Gly3P_dh_N" amino acids 45 to 102 (58 residues), 26.3 bits, see alignment E=1.7e-09 PF14748: P5CR_dimer" amino acids 162 to 266 (105 residues), 120.3 bits, see alignment E=1.1e-38

Best Hits

Swiss-Prot: 69% identical to P5CR_PSEAE: Pyrroline-5-carboxylate reductase (proC) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K00286, pyrroline-5-carboxylate reductase [EC: 1.5.1.2] (inferred from 100% identity to psb:Psyr_0476)

Predicted SEED Role

"Pyrroline-5-carboxylate reductase (EC 1.5.1.2)" in subsystem Proline Synthesis (EC 1.5.1.2)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.5.1.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZZ76 at UniProt or InterPro

Protein Sequence (272 amino acids)

>Psyr_0476 pyrroline-5-carboxylate reductase (Pseudomonas syringae pv. syringae B728a)
MSKTRIAFVGAGNMAASLIGGLRAQGVEAALISASAPGAETRERIANDHGIQVFADNADA
IKGVDVVVLAVKPQMMKTVCQALKSGLEPHQLIVSVAAGITCASLTQWLGEQPVVRCMPN
TPSLLRQGASGLYATDNVTPEQREQAEALLAAVGIAVWVEQEKHMDAVTAVSGSGPAYFF
LMMEAMTAAGVKLGLPEDIAKKLTLQTALGSALIATGSDAGAGELRRRVTSPGGTTEAAI
KAFQAGGFEALVETALTAADHRAAELAEQLGK