Protein Info for Psyr_0468 in Pseudomonas syringae pv. syringae B728a

Annotation: Aminotransferase, class I and II

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00155: Aminotran_1_2
  • amino acids 37 to 388 (352 residues), 214.3 bits, E=1.5e-67

Best Hits

Swiss-Prot: 88% identical to ALAC_ECOLI: Glutamate-pyruvate aminotransferase AlaC (alaC) from Escherichia coli (strain K12)

KEGG orthology group: K14261, alanine-synthesizing transaminase [EC: 2.6.1.-] (inferred from 99% identity to pst:PSPTO_5058)

MetaCyc: 88% identical to glutamate--pyruvate aminotransferase AlaC (Escherichia coli K-12 substr. MG1655)
Alanine transaminase. [EC: 2.6.1.2]

Predicted SEED Role

"Uncharacterized PLP-dependent aminotransferase YfdZ"

MetaCyc Pathways

• superpathway of L-alanine biosynthesis (4/4 steps found)
• L-alanine biosynthesis II (1/1 steps found)
• L-alanine degradation III (1/1 steps found)
• C4 photosynthetic carbon assimilation cycle, NAD-ME type (8/11 steps found)
• anaerobic energy metabolism (invertebrates, cytosol) (5/7 steps found)
• L-alanine degradation II (to D-lactate) (2/3 steps found)
• L-alanine degradation V (oxidative Stickland reaction) (1/2 steps found)
• C4 photosynthetic carbon assimilation cycle, PEPCK type (9/14 steps found)
• pyruvate fermentation to acetate and alanine (1/3 steps found)
• superpathway of anaerobic energy metabolism (invertebrates) (11/17 steps found)
• L-alanine degradation VI (reductive Stickland reaction) (1/6 steps found)
• superpathway of L-alanine fermentation (Stickland reaction) (3/9 steps found)
• Methanobacterium thermoautotrophicum biosynthetic metabolism (21/56 steps found)

KEGG Metabolic Maps

• Alanine and aspartate metabolism
• Aminophosphonate metabolism
• Arginine and proline metabolism
• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Caprolactam degradation
• Carbon fixation in photosynthetic organisms
• Glutamate metabolism
• Lysine biosynthesis
• Lysine degradation
• Methionine metabolism
• Nucleotide sugars metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.6.1.-, 2.6.1.2

Use Curated BLAST to search for 2.6.1.- or 2.6.1.2

Sequence Analysis Tools

See Q4ZZ84 at UniProt or InterPro

Protein Sequence (402 amino acids)

>Psyr_0468 Aminotransferase, class I and II (Pseudomonas syringae pv. syringae B728a)
MADQGSPRRFARIDRLPPYVFNITAELKMAARRRGEDIIDLSMGNPDGATPPHIVDKLIT
VAQREDTHGYSTSRGIPRLRRAISNWYKKRYEVDIDPESEAIVTIGSKEGLAHLMLATLD
QGDTVLVPNPSYPIHIYGAVIAGAQVRSVPLVPGVDFFDELEKAIRGSIPKPKMMILGFP
SNPTAQCVELDFFERVVALAKQYDVLVVHDLAYADIVYDGWKAPSIMQVPGAKDIAVEFF
TLSKSYNMAGWRIGFMVGNPELVNALARIKSYHDYGTFTPLQVAAIAALEGDQQCVLDIA
EQYRQRRNVLVKGLHELGWMVENPKASMYVWAKIPQAYAHLGSLEFAKKLLAEAKVCVSP
GIGFGEYGDDHVRFALIENQDRIRQAVRGIRSMFRADDKLKS