Protein Info for Psyr_0455 in Pseudomonas syringae pv. syringae B728a

Annotation: Amine oxidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00890: FAD_binding_2
  • amino acids 30 to 69 (40 residues), 30.3 bits, 7.7e-11
• PF01266: DAO
  • amino acids 31 to 270 (240 residues), 43.1 bits, E=1.2e-14
• PF12831: FAD_oxidored
  • amino acids 31 to 77 (47 residues), 27.3 bits, 7e-10
• PF13450: NAD_binding_8
  • amino acids 32 to 66 (35 residues), 37 bits, see alignment (E = 1e-12)
• PF01593: Amino_oxidase
  • amino acids 37 to 452 (416 residues), 150.4 bits, E=3e-47

Best Hits

KEGG orthology group: K00274, monoamine oxidase [EC: 1.4.3.4] (inferred from 95% identity to psp:PSPPH_0446)

Predicted SEED Role

"Monoamine oxidase"

MetaCyc Pathways

• phenylethylamine degradation I (2/2 steps found)
• L-tryptophan degradation X (mammalian, via tryptamine) (3/4 steps found)
• putrescine degradation III (2/4 steps found)
• salidroside biosynthesis (2/4 steps found)
• serotonin degradation (4/7 steps found)
• L-tryptophan degradation VI (via tryptamine) (1/3 steps found)
• noradrenaline and adrenaline degradation (8/13 steps found)
• dopamine degradation (2/5 steps found)
• phenylethanol biosynthesis (2/5 steps found)
• melatonin degradation II (1/4 steps found)
• L-phenylalanine degradation IV (mammalian, via side chain) (4/9 steps found)
• aromatic biogenic amine degradation (bacteria) (3/8 steps found)
• superpathway of phenylethylamine degradation (5/11 steps found)
• superpathway of melatonin degradation (1/11 steps found)

KEGG Metabolic Maps

• Alkaloid biosynthesis I
• Arginine and proline metabolism
• Drug metabolism - cytochrome P450
• Glycine, serine and threonine metabolism
• Histidine metabolism
• Phenylalanine metabolism
• Tryptophan metabolism
• Tyrosine metabolism
• Urea cycle and metabolism of amino groups

Isozymes

Compare fitness of predicted isozymes for: 1.4.3.4

Use Curated BLAST to search for 1.4.3.4

Sequence Analysis Tools

See Q4ZZ97 at UniProt or InterPro

Protein Sequence (624 amino acids)

>Psyr_0455 Amine oxidase (Pseudomonas syringae pv. syringae B728a)
MLSGWLRACALIVAGLVSVSTLADEKQRTAIVVGGGLAGLTAAYELQAKGWQVTLLEAKP
SLGGRSGLATSEWIGNTKAQPVLNRYLDSFKLPTVPAPEFVRTPSYLIDGVYFTQADLAV
KQPATAEAIKRYNDTLDNLARSVDDPENPASNSTLFALDQINVANWLDRLNLPVTARQLI
NQQIRTRYDEPSRLSLLYLAQQSRVYRSVDERDLRAARLPGGSAVLTQAFVKQLKTVKTS
SPVTAVIQEKDKVTVKAGATSYTADYAVMAVPLRSLGKIQMTPALDAQHMGAIKSTNYGW
RDQIMLKFKTPVWDSKARMSGEVFSNTGLGMLWVEPALKGGANVVINLSGDNARIMQAFG
DKQMVDQVLIRLHAFYPEARGAYTGYEIRRYSVDPSTGGSYLAFGPGQISKYWRLWERPI
LRVAFAGEHTDTLYPGTLEGALRSGQRAAGQVQDLAAGKSFEPVKVAPPKAPAPAAQKSE
GNFFSNLFGGSSDKPAEPAKPQADKPGFFSRIFGGGEQPAPAPAPVEKAVEPAPAPAPAA
APAPVVAPVVQPAKPPVKAEPAKKPATKAEPAKKVQSKEAARKEAAKKEAAKKEAAKKEA
AKKAQSKPAPAKTPADAAPADANN