Protein Info for Psyr_0444 in Pseudomonas syringae pv. syringae B728a

Annotation: Malonate decarboxylase delta subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR03130: malonate decarboxylase acyl carrier protein
  • amino acids 2 to 95 (94 residues), 111.4 bits, E=7.6e-37
• PF06857: ACP
  • amino acids 17 to 95 (79 residues), 78.1 bits, E=2.5e-26

Best Hits

Swiss-Prot: 100% identical to MDCC_PSEU2: Malonate decarboxylase acyl carrier protein (mdcC) from Pseudomonas syringae pv. syringae (strain B728a)

KEGG orthology group: K13931, malonate decarboxylase delta subunit (inferred from 100% identity to psb:Psyr_0444)

MetaCyc: 52% identical to malonate decarboxylase [acyl carrier protein] component (Klebsiella pneumoniae)
Biotin-independent malonate decarboxylase. [EC: 4.1.1.88]

Predicted SEED Role

"Malonate decarboxylase delta subunit" in subsystem Malonate decarboxylase

Isozymes

Compare fitness of predicted isozymes for: 4.1.1.88

Use Curated BLAST to search for 4.1.1.88

Sequence Analysis Tools

See Q4ZZA8 at UniProt or InterPro

Protein Sequence (99 amino acids)

>Psyr_0444 Malonate decarboxylase delta subunit (Pseudomonas syringae pv. syringae B728a)
METLSFEFPAGQPPKGRALVGVVGSGDLEVLLEPGKPGTLSIQVVTSVNGAALRWQHLFE
RMFDGQTPPALSIDIHDFGATPGVVRMRLEQGFEEIGHD