Protein Info for Psyr_0417 in Pseudomonas syringae pv. syringae B728a

Annotation: gluconate permease GntT

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 449 transmembrane" amino acids 6 to 25 (20 residues), see Phobius details amino acids 32 to 55 (24 residues), see Phobius details amino acids 65 to 83 (19 residues), see Phobius details amino acids 104 to 132 (29 residues), see Phobius details amino acids 140 to 161 (22 residues), see Phobius details amino acids 181 to 201 (21 residues), see Phobius details amino acids 231 to 253 (23 residues), see Phobius details amino acids 264 to 289 (26 residues), see Phobius details amino acids 305 to 326 (22 residues), see Phobius details amino acids 344 to 383 (40 residues), see Phobius details amino acids 389 to 412 (24 residues), see Phobius details amino acids 424 to 446 (23 residues), see Phobius details TIGR00791: transporter, gluconate:H+ symporter (GntP) family" amino acids 10 to 448 (439 residues), 475.4 bits, see alignment E=1e-146 PF02447: GntP_permease" amino acids 10 to 447 (438 residues), 516.2 bits, see alignment E=6.9e-159 PF03600: CitMHS" amino acids 28 to 395 (368 residues), 56.6 bits, see alignment E=2.4e-19

Best Hits

Swiss-Prot: 51% identical to GNTP_ZYMMO: Gluconate permease (gntP) from Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4)

KEGG orthology group: None (inferred from 100% identity to psb:Psyr_0417)

Predicted SEED Role

"Gluconate transporter family protein" in subsystem D-gluconate and ketogluconates metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZZD5 at UniProt or InterPro

Protein Sequence (449 amino acids)

>Psyr_0417 gluconate permease GntT (Pseudomonas syringae pv. syringae B728a)
MSPSPGISLLVYAAVAIIALIVLIARYRLNPFIVITLVSVGLALVAGMPASGVVASYEAG
VGKTLGHIALVVALGTMLGKMMAESGGAEQVARTLIDRFGERNAHWAMVCIAFLVGLPLF
FEVGFVLLVPIAFTVARRVGVSILMVGLPMVAGLSVVHALVPPHPAAMLAVQAYQASVGQ
TLFYAILIGIPTAIIAGPVYAKFIVPRIHLPAENPLAKQFLDREPRQKLPSFGLTMATIL
LPVVLMLLGGWANLISTPGSAFNSFLLFIGNSVIALLLATLLSFWTLGIAQGFNRDSILK
FTNECLAPTASITLLVGAGGGLNRILIDSGVTNEIVGLAQDFHLSPLLMGWLFAALMRVA
TGSATVAMTTASGIVAPVAMGLGYPHPELLVLATGAGSVIFSHVNDGGFWLIKEYFNMTV
AQTFKTWTVLETLISVVAFALTLGLAQVL