Protein Info for Psyr_0404 in Pseudomonas syringae pv. syringae B728a

Annotation: Fimbrial assembly

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 191 transmembrane" amino acids 21 to 39 (19 residues), see Phobius details PF05137: PilN" amino acids 100 to 177 (78 residues), 77.5 bits, see alignment E=3.4e-26

Best Hits

KEGG orthology group: K02663, type IV pilus assembly protein PilN (inferred from 100% identity to psb:Psyr_0404)

Predicted SEED Role

"Type IV pilus biogenesis protein PilN" in subsystem Type IV pilus

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZZE8 at UniProt or InterPro

Protein Sequence (191 amino acids)

>Psyr_0404 Fimbrial assembly (Pseudomonas syringae pv. syringae B728a)
MARINLLPWREELREERKKRFLTALVGVLVVSVGILFLIDRYVSNALEHQMARNAFLQTQ
IAQLDIRIKEISDLKARRKQLLERMKIIQDLQGNRPITGRVFDQLARTLPDGVYYSQVKM
TDKLIAINGAAESNNRVSDLMRNLEASDWLEAPSLTEVKATTAGAVDQANVFQLTVRQTQ
PPVAAAAGAKP