Protein Info for Psyr_0395 in Pseudomonas syringae pv. syringae B728a

Annotation: HslV component of HslUV peptidase, Threonine peptidase, MEROPS family T01B

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 192 TIGR03692: ATP-dependent protease HslVU, peptidase subunit" amino acids 18 to 187 (170 residues), 283.6 bits, see alignment E=2.3e-89 PF00227: Proteasome" amino acids 18 to 186 (169 residues), 84.3 bits, see alignment E=4.5e-28

Best Hits

Swiss-Prot: 99% identical to HSLV_PSE14: ATP-dependent protease subunit HslV (hslV) from Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)

KEGG orthology group: K01419, ATP-dependent HslUV protease, peptidase subunit HslV [EC: 3.4.25.2] (inferred from 99% identity to pst:PSPTO_5140)

MetaCyc: 77% identical to peptidase component of the HslVU protease (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"ATP-dependent protease HslV (EC 3.4.25.-)" in subsystem Proteasome bacterial or Proteolysis in bacteria, ATP-dependent (EC 3.4.25.-)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.4.25.- or 3.4.25.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZZF7 at UniProt or InterPro

Protein Sequence (192 amino acids)

>Psyr_0395 HslV component of HslUV peptidase, Threonine peptidase, MEROPS family T01B (Pseudomonas syringae pv. syringae B728a)
MSLHQGIFAPQCGDSPLTTIVSVRRHGKVVMAGDGQVSLGNTVMKGNAKKVRRLYHGEVI
AGFAGATADAFTLFERFEAQLEKHQGHLVRAAVELAKDWRTDRSLSRLEAMLAVANKDAS
LIITGNGDVVEPEDGLIAMGSGGAFAQAAARALLLKTDLSAREIAETSLHIAGDICVFTN
HNITIEEQDLAG