Protein Info for Psyr_0385 in Pseudomonas syringae pv. syringae B728a

Annotation: phosphoribosyl-ATP pyrophosphatase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 110 TIGR03188: phosphoribosyl-ATP diphosphatase" amino acids 5 to 92 (88 residues), 93.9 bits, see alignment E=2.7e-31 PF01503: PRA-PH" amino acids 6 to 95 (90 residues), 55 bits, see alignment E=4.6e-19

Best Hits

Swiss-Prot: 100% identical to HIS2_PSEU2: Phosphoribosyl-ATP pyrophosphatase (hisE) from Pseudomonas syringae pv. syringae (strain B728a)

KEGG orthology group: K01523, phosphoribosyl-ATP pyrophosphohydrolase [EC: 3.6.1.31] (inferred from 98% identity to pst:PSPTO_5154)

Predicted SEED Role

"Phosphoribosyl-ATP pyrophosphatase (EC 3.6.1.31)" in subsystem Histidine Biosynthesis (EC 3.6.1.31)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.6.1.31

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZZG7 at UniProt or InterPro

Protein Sequence (110 amino acids)

>Psyr_0385 phosphoribosyl-ATP pyrophosphatase (Pseudomonas syringae pv. syringae B728a)
MTDTLSRLAEVLESRKDAAADSSYVASLYHKGLNKILEKLGEESIETIIAAKDAAVSGNC
SDVIYETADLWFHSMVMLAALGQHPQAVLDELDRRFGLSGHAEKAARTAE