Protein Info for Psyr_0362 in Pseudomonas syringae pv. syringae B728a

Annotation: Sigma-70 region 2

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 188 TIGR02937: RNA polymerase sigma factor, sigma-70 family" amino acids 24 to 187 (164 residues), 85.2 bits, see alignment E=1.9e-28 PF04542: Sigma70_r2" amino acids 28 to 96 (69 residues), 61.7 bits, see alignment E=6.6e-21 PF08281: Sigma70_r4_2" amino acids 132 to 183 (52 residues), 50.7 bits, see alignment E=1.7e-17 PF04545: Sigma70_r4" amino acids 136 to 185 (50 residues), 33 bits, see alignment E=5.1e-12

Best Hits

KEGG orthology group: K03088, RNA polymerase sigma-70 factor, ECF subfamily (inferred from 100% identity to psb:Psyr_0362)

Predicted SEED Role

"DNA-directed RNA polymerase specialized sigma subunit, sigma24-like"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZZI8 at UniProt or InterPro

Protein Sequence (188 amino acids)

>Psyr_0362 Sigma-70 region 2 (Pseudomonas syringae pv. syringae B728a)
MSSHESLFDYEATLQACARGEKQALQRLYQQESARLLGVAQRLVRDRALAEDIVHDAFLK
IWSHAASFDASRGSARGWIFSVTRHLALNTLRNTTREVRVEDDGSEDHHEQATLEGWQEI
GDAFDWQVNPGRITSCLEQLEPVRRNCIFHAYVDGYSHQEIAQKIGAPLGTVKAWIKRSL
TALRECMG