Protein Info for Psyr_0350 in Pseudomonas syringae pv. syringae B728a

Annotation: ABC transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 376 PF00005: ABC_tran" amino acids 54 to 201 (148 residues), 125.9 bits, see alignment E=2.8e-40 PF09383: NIL" amino acids 300 to 365 (66 residues), 45.8 bits, see alignment E=6.7e-16

Best Hits

Swiss-Prot: 100% identical to METN2_PSEU2: Methionine import ATP-binding protein MetN 2 (metN2) from Pseudomonas syringae pv. syringae (strain B728a)

KEGG orthology group: K02071, D-methionine transport system ATP-binding protein (inferred from 100% identity to psb:Psyr_0350)

Predicted SEED Role

"Methionine ABC transporter ATP-binding protein" in subsystem Methionine Biosynthesis or Methionine Degradation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZZK0 at UniProt or InterPro

Protein Sequence (376 amino acids)

>Psyr_0350 ABC transporter (Pseudomonas syringae pv. syringae B728a)
MTATAQRQRPIDTTGAGQRAQQAELHPELNRAHVRFINLGKTYHGKQGPVEALGNIDLAV
QHGEIFGIIGRSGAGKSSLIRTINRLEQPSNGRVLIDQVDIGEFDEDKLVELRRRIGMIF
QHFNLMSAKNVWQNVELPLKVAGVPREQRARKVAQLLELVGLQDKHKAYPAQLSGGQKQR
VGIARALVHDPAILLCDEATSALDPETTQSILGLLREINQRLGLTIVLITHEMAVIRDIC
HRVVVLEQGRIVEQGPVWQVFGDPQHEVSKTLLAPLQTGLPKEWAERLSDQPQRPDAALL
LDVHFTGVSAEGPDLAALFTALGGKVELLQGGVERIQDRAIGHLILSVAGSPHSRDELLA
RARTLAPRAEVLGYVG