Protein Info for Psyr_0349 in Pseudomonas syringae pv. syringae B728a

Annotation: Binding-protein-dependent transport systems inner membrane component

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 214 transmembrane" amino acids 14 to 37 (24 residues), see Phobius details amino acids 55 to 76 (22 residues), see Phobius details amino acids 84 to 102 (19 residues), see Phobius details amino acids 143 to 165 (23 residues), see Phobius details amino acids 185 to 204 (20 residues), see Phobius details PF00528: BPD_transp_1" amino acids 47 to 214 (168 residues), 85.2 bits, see alignment E=2.5e-28

Best Hits

Swiss-Prot: 53% identical to METI_YERPE: D-methionine transport system permease protein MetI (metI) from Yersinia pestis

KEGG orthology group: K02072, D-methionine transport system permease protein (inferred from 100% identity to psb:Psyr_0349)

MetaCyc: 49% identical to L-methionine/D-methionine ABC transporter membrane subunit (Escherichia coli K-12 substr. MG1655)
RXN0-4522 [EC: 7.4.2.11]; 7.4.2.11 [EC: 7.4.2.11]; TRANS-RXN-383 [EC: 7.4.2.11]; TRANS-RXN0-510 [EC: 7.4.2.11]; TRANS-RXN0-511 [EC: 7.4.2.11]

Predicted SEED Role

"Methionine ABC transporter permease protein" in subsystem Methionine Biosynthesis or Methionine Degradation

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.4.2.11

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZZK1 at UniProt or InterPro

Protein Sequence (214 amino acids)

>Psyr_0349 Binding-protein-dependent transport systems inner membrane component (Pseudomonas syringae pv. syringae B728a)
MWVDRLLQGTLDTFLMVGVSSLIALLLGIPLAVILVTSSKGGIYAAPGINRVLGGFVNLF
RSIPFLILMVALIPFTRMIVGTTYGVWAAVVPLTIAATPFFARIAEVSLREVDHGLVEAA
QAMGCRRWHIIWHVLLPEARPGIVGGFTITLVTMINSSAMAGAIGAGGLGDIAYRYGYQR
FDTQVMLTVIVLLVAVVALVQLGGDRLARSFDRR