Protein Info for Psyr_0339 in Pseudomonas syringae pv. syringae B728a

Annotation: Binding-protein-dependent transport systems inner membrane component

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 311 signal peptide" amino acids 1 to 13 (13 residues), see Phobius details transmembrane" amino acids 59 to 79 (21 residues), see Phobius details amino acids 86 to 105 (20 residues), see Phobius details amino acids 111 to 137 (27 residues), see Phobius details amino acids 149 to 170 (22 residues), see Phobius details amino acids 176 to 197 (22 residues), see Phobius details amino acids 217 to 240 (24 residues), see Phobius details amino acids 246 to 265 (20 residues), see Phobius details amino acids 277 to 299 (23 residues), see Phobius details PF00528: BPD_transp_1" amino acids 121 to 294 (174 residues), 54 bits, see alignment E=9.1e-19

Best Hits

KEGG orthology group: K02050, sulfonate/nitrate/taurine transport system permease protein (inferred from 100% identity to psb:Psyr_0339)

Predicted SEED Role

"Taurine transport system permease protein TauC" in subsystem Taurine Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZZL1 at UniProt or InterPro

Protein Sequence (311 amino acids)

>Psyr_0339 Binding-protein-dependent transport systems inner membrane component (Pseudomonas syringae pv. syringae B728a)
MLCVLMLPRAFCIRFLRLPRTRIMSLAPPAREEYEITLEPFTQEDLARDLPLAQRIWQLG
WVRKCVIMIALAVIWELAARLQNNDLLLPSFLQTAAAFYDGLISGELPGKVWISLTVLIQ
GYLIGIVLAFALTTLAVSTQLGRDLLSTLTAMFNPLPAIALLPLALLWFGLGQNSLIFVL
VHSVLWALALNTYAGFLGVSETQRMAGRNYGLKGLRFVWHILIPAALPSILAGLKIGWAF
AWRTLIAAELVFGASSGKGGLGWYIFQNRNELYTDKVFAGLAAVILIGLLVENLLFANIE
RLTVKRWGMQR