Protein Info for Psyr_0322 in Pseudomonas syringae pv. syringae B728a

Annotation: 2-octaprenyl-6-methoxyphenol hydroxylase / 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 395 signal peptide" amino acids 1 to 29 (29 residues), see Phobius details TIGR01984: 2-polyprenyl-6-methoxyphenol 4-hydroxylase" amino acids 5 to 388 (384 residues), 439.8 bits, see alignment E=7.8e-136 PF01494: FAD_binding_3" amino acids 5 to 317 (313 residues), 71.5 bits, see alignment E=7.7e-24 TIGR01988: ubiquinone biosynthesis hydroxylase, UbiH/UbiF/VisC/COQ6 family" amino acids 5 to 388 (384 residues), 398.5 bits, see alignment E=2.8e-123

Best Hits

KEGG orthology group: K03185, 2-octaprenyl-6-methoxyphenol hydroxylase [EC: 1.14.13.-] (inferred from 100% identity to psb:Psyr_0322)

Predicted SEED Role

"2-octaprenyl-6-methoxyphenol hydroxylase (EC 1.14.13.-)" in subsystem Ubiquinone Biosynthesis (EC 1.14.13.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.14.13.-

Use Curated BLAST to search for 1.14.13.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZZM8 at UniProt or InterPro

Protein Sequence (395 amino acids)

>Psyr_0322 2-octaprenyl-6-methoxyphenol hydroxylase / 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase (Pseudomonas syringae pv. syringae B728a)
MSRFNIAIVGGGLVGASLALSLQAGAKARGWKIVLIEPFAPGEAWQPSYDARSSALSFGS
RRIYERLGLWQQISRRAEPILQIQVSDRGRFGATRLSAIEEGVPALGYVVENAWLGQALW
AGLDRDVVSWRVPAEVKHMQPLADGYRLSLSDDSELDCDLAVLADGGRSSLREQLGIGVR
QRPYDQHALIANITPSEAHCGQAFERFTEDGPMALLPLPDNRCALVWTRPGNDTQRLAEL
DDRSFLEELQGVFGYRLGTLRQVGARHVYPLALIEAEEQVRSHLVILGNAAHSLHPVAGQ
GFNLSLRDADALAETLLDSDAPPGALPTLQLYRERQRQDQQLTVGFSDKVTRLFGSSRSA
VATGRNVGLLGLDLLPAAKRWFARQAMGLGTRSDV