Protein Info for Psyr_0317 in Pseudomonas syringae pv. syringae B728a

Annotation: 5-formyltetrahydrofolate cyclo-ligase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 203 PF01812: 5-FTHF_cyc-lig" amino acids 10 to 189 (180 residues), 140.7 bits, see alignment E=2.7e-45 TIGR02727: 5-formyltetrahydrofolate cyclo-ligase" amino acids 11 to 191 (181 residues), 154.5 bits, see alignment E=1.4e-49

Best Hits

Swiss-Prot: 37% identical to 5FCL_ECO57: 5-formyltetrahydrofolate cyclo-ligase (ygfA) from Escherichia coli O157:H7

KEGG orthology group: K01934, 5-formyltetrahydrofolate cyclo-ligase [EC: 6.3.3.2] (inferred from 100% identity to psb:Psyr_0317)

MetaCyc: 37% identical to putative 5-formyltetrahydrofolate cyclo-ligase (Escherichia coli K-12 substr. MG1655)
5-formyltetrahydrofolate cyclo-ligase. [EC: 6.3.3.2]

Predicted SEED Role

"5-formyltetrahydrofolate cyclo-ligase (EC 6.3.3.2)" in subsystem Folate Biosynthesis or One-carbon metabolism by tetrahydropterines or Serine-glyoxylate cycle (EC 6.3.3.2)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.3.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZZN3 at UniProt or InterPro

Protein Sequence (203 amino acids)

>Psyr_0317 5-formyltetrahydrofolate cyclo-ligase (Pseudomonas syringae pv. syringae B728a)
MISAQSLTRPQLRRQLRKARKALSQSQQRAAARDIYRQLAQHPLFRRARHVSLYLPMDGE
IDPRLLLREAQRRGKATYLPVLNAWPRTRMVFQRVRPGETFIPNRFRIPEPRIDRARQRP
VWALDLILMPLVGFDDEGGRLGMGGGFYDRSLAYLARRKTWRKPLLLGLAHECQKVDRLA
QASWDVPLHGTLSDKGWYVTQTL