Protein Info for Psyr_0296 in Pseudomonas syringae pv. syringae B728a

Annotation: amino acid ABC transporter membrane protein 2, PAAT family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 215 transmembrane" amino acids 15 to 38 (24 residues), see Phobius details amino acids 58 to 79 (22 residues), see Phobius details amino acids 85 to 104 (20 residues), see Phobius details amino acids 139 to 163 (25 residues), see Phobius details amino acids 183 to 203 (21 residues), see Phobius details TIGR01726: amino ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine family" amino acids 10 to 106 (97 residues), 95.8 bits, see alignment E=9.1e-32 PF00528: BPD_transp_1" amino acids 43 to 211 (169 residues), 57 bits, see alignment E=1.1e-19

Best Hits

Swiss-Prot: 38% identical to YECS_ECOL6: L-cystine transport system permease protein YecS (yecS) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K02029, polar amino acid transport system permease protein (inferred from 100% identity to psb:Psyr_0296)

MetaCyc: 38% identical to cystine ABC transporter membrane subunit (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-290 [EC: 7.4.2.12]; 7.4.2.12 [EC: 7.4.2.12]; 7.4.2.- [EC: 7.4.2.12]; 7.4.2.- [EC: 7.4.2.12]; 7.4.2.- [EC: 7.4.2.12]; 7.4.2.- [EC: 7.4.2.12]

Predicted SEED Role

"Putative amino acid ABC transporter, permease protein"

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.4.2.12

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZZQ3 at UniProt or InterPro

Protein Sequence (215 amino acids)

>Psyr_0296 amino acid ABC transporter membrane protein 2, PAAT family (Pseudomonas syringae pv. syringae B728a)
MDFTLWDIVRNLLIGLQWTVALSLVAFIGGGLIGLLIMGMRTSEKSGPRVTAKLYIELFQ
GTPLLMQLFLVFFGVALMGLNISPWAAAALALTLFTSAYLAEIWRGCVESISKGQWEASA
SLALTPFEQMRYVILPQALRIAVAPTVGFSVQVVKGTAVTSIIGFTELTKTGSMLANATF
EPFMVYGFVALGYFILCYPLSLCARHLERRLHASA