Protein Info for Psyr_0295 in Pseudomonas syringae pv. syringae B728a

Annotation: amino acid ABC transporter ATP-binding protein, PAAT family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 244 PF00005: ABC_tran" amino acids 19 to 167 (149 residues), 128 bits, see alignment E=8.1e-41 PF13401: AAA_22" amino acids 29 to 194 (166 residues), 28.1 bits, see alignment E=4.7e-10

Best Hits

Swiss-Prot: 54% identical to GLUA_CORGL: Glutamate transport ATP-binding protein GluA (gluA) from Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025)

KEGG orthology group: K02028, polar amino acid transport system ATP-binding protein [EC: 3.6.3.21] (inferred from 100% identity to psp:PSPPH_0282)

MetaCyc: 52% identical to L-glutamine ABC transporter ATP binding subunit (Escherichia coli K-12 substr. MG1655)
ABC-12-RXN [EC: 7.4.2.1]

Predicted SEED Role

"ABC-type polar amino acid transport system, ATPase component"

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.21

Use Curated BLAST to search for 3.6.3.21 or 7.4.2.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZZQ4 at UniProt or InterPro

Protein Sequence (244 amino acids)

>Psyr_0295 amino acid ABC transporter ATP-binding protein, PAAT family (Pseudomonas syringae pv. syringae B728a)
MPLLRISALHKYYGDHHVLKGIDLSVEEGQVVAIIGRSGSGKSTLLRTLNGLESINDGVI
EVDGEYLDAARADLRTLRQKVGMVFQQFNLFPHLSVGENVMLAPQVVQKVPKAEAAKLAR
KMLERVGLGEKFDAFPDRLSGGQQQRVAIARALAMSPKVLLCDEITSALDPELVNEVLSV
VRQLAADGMTLIMVTHEMRFAREVGDKLVFMHQGKVHEVGDPKELFANPKTPELANFIGT
VEHA