Protein Info for Psyr_0287 in Pseudomonas syringae pv. syringae B728a

Annotation: Sulphate transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 510 transmembrane" amino acids 14 to 35 (22 residues), see Phobius details amino acids 43 to 62 (20 residues), see Phobius details amino acids 82 to 101 (20 residues), see Phobius details amino acids 113 to 135 (23 residues), see Phobius details amino acids 157 to 180 (24 residues), see Phobius details amino acids 192 to 212 (21 residues), see Phobius details amino acids 242 to 264 (23 residues), see Phobius details amino acids 285 to 304 (20 residues), see Phobius details amino acids 323 to 353 (31 residues), see Phobius details amino acids 373 to 401 (29 residues), see Phobius details PF00916: Sulfate_transp" amino acids 13 to 379 (367 residues), 201.1 bits, see alignment E=1.3e-63

Best Hits

KEGG orthology group: None (inferred from 100% identity to psb:Psyr_0287)

Predicted SEED Role

"Sulfate transporter family protein in cluster with carbonic anhydrase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZZR2 at UniProt or InterPro

Protein Sequence (510 amino acids)

>Psyr_0287 Sulphate transporter (Pseudomonas syringae pv. syringae B728a)
MGITALKTALPRELLASVVVFLVALPLCMGIAIASGMPPAKGLITGIVGGLIVGWIAGSP
LQVSGPAAGLAVLVFEVVREHGMAMLGPILVLAGLLQLLAGRFKLGCWFRVTAPAVVYGM
LAGIGVLIVLSQAHVMFDSGPKPSGLDNLIAFPSTLIQAFGPGTGMQAGMLGLGTMLIMW
GWEKLRPQSLRFVPGALLGVGIATGISLFMALQVKRVEVPDNLADAIDWLRPADLMNLAD
PAILVAAIVVAFIASAETLLSASAVDRMHSGQRSDFDKELSAQGVGNMLCGVLGALPMTG
VIVRSSANVQAGATTRFSTIFHGLWLLAFVLLLSSVLQSIPVASLAGVLVYTGLKLVDLK
AFRGLGRYGRMPMFTYAATAVAIIFTDLLTGVLVGFGLTLVKLAFKASRLKINVVELAGE
KEFELRLVGAATFLKVPALTQALGTIPQGSTVHVPLGNLSYIDHSCLELLEEWGRSNAAH
GTRLLIEPRGLKRRLEGRIYTTTGIGSGAA