Protein Info for Psyr_0277 in Pseudomonas syringae pv. syringae B728a

Annotation: ABC transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00005: ABC_tran
  • amino acids 21 to 149 (129 residues), 100 bits, E=1.8e-32

Best Hits

Swiss-Prot: 100% identical to ZNUC_PSEU2: Zinc import ATP-binding protein ZnuC (znuC) from Pseudomonas syringae pv. syringae (strain B728a)

KEGG orthology group: K09817, zinc transport system ATP-binding protein [EC: 3.6.3.-] (inferred from 100% identity to psb:Psyr_0277)

MetaCyc: 60% identical to Zn2+ ABC transporter ATP binding subunit (Escherichia coli K-12 substr. MG1655)
ABC-63-RXN [EC: 7.2.2.20]

Predicted SEED Role

"Zinc ABC transporter, ATP-binding protein ZnuC" in subsystem Transport of Zinc

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.-

Use Curated BLAST to search for 3.6.3.- or 7.2.2.20

Sequence Analysis Tools

See Q4ZZS2 at UniProt or InterPro

Protein Sequence (262 amino acids)

>Psyr_0277 ABC transporter (Pseudomonas syringae pv. syringae B728a)
MSDALIRLDKVAVTLSGQNVLDDIQLSVKPGEIVTLIGPNGAGKTTLVRAVLGLLKPDSG
TVWRKPKLRVGYMPQKLHVDQTLPLSVLRFLRLVPGVDRTAAASALEEVGAGKVIDSPIQ
GISGGEMQRVLLARALLRKPELLVLDEPVQGVDVAGQAELYSLITRLRDRHRCGVLMVSH
DLHLVMSTTDQVVCLNRHVCCSGHPEQVSHDPAFVELFGKNAQSLAIYHHHHDHAHDLHG
AVVNDAAPLSHTHVHGDSCKHG