Protein Info for Psyr_0228 in Pseudomonas syringae pv. syringae B728a

Annotation: Major facilitator superfamily

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 382 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details transmembrane" amino acids 37 to 59 (23 residues), see Phobius details amino acids 71 to 94 (24 residues), see Phobius details amino acids 100 to 117 (18 residues), see Phobius details amino acids 129 to 151 (23 residues), see Phobius details amino acids 157 to 174 (18 residues), see Phobius details amino acids 201 to 222 (22 residues), see Phobius details amino acids 233 to 254 (22 residues), see Phobius details amino acids 263 to 283 (21 residues), see Phobius details amino acids 289 to 310 (22 residues), see Phobius details amino acids 322 to 341 (20 residues), see Phobius details amino acids 348 to 368 (21 residues), see Phobius details PF07690: MFS_1" amino acids 12 to 240 (229 residues), 49.6 bits, see alignment E=2.9e-17 amino acids 203 to 367 (165 residues), 50.8 bits, see alignment E=1.2e-17 PF06779: MFS_4" amino acids 40 to 368 (329 residues), 29.1 bits, see alignment E=6.8e-11

Best Hits

KEGG orthology group: None (inferred from 100% identity to psb:Psyr_0228)

Predicted SEED Role

"Major facilitator family transporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZZX1 at UniProt or InterPro

Protein Sequence (382 amino acids)

>Psyr_0228 Major facilitator superfamily (Pseudomonas syringae pv. syringae B728a)
MRWGTYFAVLASVLGVGLAMGVSMPLVSLRLAGWGYGSFAIGIMAAMPAVGVLLGAALAS
RLAARFGTANLMRLCLWAGAVSVGALALLPYYWIWLVLRLTLGVILTIVFVLGESWINQL
VIERLRGRLVALYGSTYALSQLAGPLLLGVIGTQADYGFWIGVALLVGSPFLLLGRTGAP
STEACNVTFADLSGFCRGMPAIAWAVALFAAFEALILTLLPLYCIRHGFTPEIALIMVSV
VVVGDALLQLPIGMLADRISRRAMFTGCAALLLASSLLVPLLIDTVLIWPLWTVFGASAG
GLFTLSLILIGERYRDDSLVRANAHVAQLWGIGCLLGPLIAGAGSQWVSGEALPLMMAAG
ALGLLILIRRRGAFGDAQAVPA