Protein Info for Psyr_0216 in Pseudomonas syringae pv. syringae B728a

Annotation: orotate phosphoribosyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 213 TIGR00336: orotate phosphoribosyltransferase" amino acids 11 to 186 (176 residues), 205.1 bits, see alignment E=3.4e-65 PF00156: Pribosyltran" amino acids 44 to 158 (115 residues), 43.4 bits, see alignment E=1.1e-15

Best Hits

Swiss-Prot: 100% identical to PYRE_PSEU2: Orotate phosphoribosyltransferase (pyrE) from Pseudomonas syringae pv. syringae (strain B728a)

KEGG orthology group: K00762, orotate phosphoribosyltransferase [EC: 2.4.2.10] (inferred from 100% identity to psb:Psyr_0216)

MetaCyc: 68% identical to orotate phosphoribosyltransferase (Escherichia coli K-12 substr. MG1655)
Orotate phosphoribosyltransferase. [EC: 2.4.2.10]

Predicted SEED Role

"Orotate phosphoribosyltransferase (EC 2.4.2.10)" in subsystem De Novo Pyrimidine Synthesis (EC 2.4.2.10)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.4.2.10

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZZY3 at UniProt or InterPro

Protein Sequence (213 amino acids)

>Psyr_0216 orotate phosphoribosyltransferase (Pseudomonas syringae pv. syringae B728a)
MQAYQRDFIRFAIDRGVLRFGEFTLKSGRTSPYFFNAGLFNTGSALAQLGRFYAAAVVES
GIAFDVLFGPAYKGIPLASATAVALAEHHDRDLPWCFNRKEAKAHGEGGSLVGSPLAGNV
LIIDDVITAGTAIREVMQIIKDQDATAAGVLIALNRQERGNGELSAIQEVERDFGIPVVS
IVSLNQVLEFLADDPQLKQHLPAVEAYRAQFGI