Protein Info for Psyr_0214 in Pseudomonas syringae pv. syringae B728a

Annotation: conserved hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 122 transmembrane" amino acids 21 to 44 (24 residues), see Phobius details amino acids 66 to 102 (37 residues), see Phobius details PF09685: MamF_MmsF" amino acids 15 to 121 (107 residues), 125.9 bits, see alignment E=4.7e-41

Best Hits

KEGG orthology group: K09940, hypothetical protein (inferred from 100% identity to psb:Psyr_0214)

Predicted SEED Role

"FIG00955116: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZZY5 at UniProt or InterPro

Protein Sequence (122 amino acids)

>Psyr_0214 conserved hypothetical protein (Pseudomonas syringae pv. syringae B728a)
MSDSLQPFSKPPQSARQWAMFCHLSAFAGLMFPFGNLLGPLIIWQLKKDSDPFIDAQGKE
ALNFQITVAIAATVSMLLVVLIIGFALLTLVGIGAAALAIIAGIKANDGVNYRYPFTLRL
IK