Protein Info for Psyr_0205 in Pseudomonas syringae pv. syringae B728a

Annotation: outer membrane transport energization protein ExbB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 320 signal peptide" amino acids 1 to 39 (39 residues), see Phobius details transmembrane" amino acids 99 to 121 (23 residues), see Phobius details amino acids 208 to 229 (22 residues), see Phobius details amino acids 251 to 274 (24 residues), see Phobius details TIGR02797: tonB-system energizer ExbB" amino acids 89 to 298 (210 residues), 343.1 bits, see alignment E=3.3e-107 PF01618: MotA_ExbB" amino acids 179 to 280 (102 residues), 108.3 bits, see alignment E=1.2e-35

Best Hits

Swiss-Prot: 73% identical to EXBB_PSEPU: Biopolymer transport protein ExbB (exbB) from Pseudomonas putida

KEGG orthology group: K03561, biopolymer transport protein ExbB (inferred from 100% identity to psb:Psyr_0205)

Predicted SEED Role

"MotA/TolQ/ExbB proton channel family protein" in subsystem Ton and Tol transport systems

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZZZ4 at UniProt or InterPro

Protein Sequence (320 amino acids)

>Psyr_0205 outer membrane transport energization protein ExbB (Pseudomonas syringae pv. syringae B728a)
MKRIQSIASPTQMPRLPRAWRSIAALVLSLMFVPMALADQSAPTAAPATSTAPASPAATA
PAAPDAAAPVQAMEPATEDNSLGMAHDLSPWGMYQNADVVVKAVMIGLAIASIMTWTIWI
SKGFELLGAKRRLRGEIANLKKARSLTEASATASTEGTLAHLLVHDALEEMRLSANSRER
EGIKERVSFRLERLVAACGRNMSMGTGVLATIGSTAPFVGLFGTVWGIMNSFIGIAKTQT
TNLAVVAPGIAEALLATALGLVAAIPAVVIYNVFARSIAGYKAQVSDASAHVLLLVSRDL
DHLPEPSERNQQQPHMVKVG